Decorin/PGS2 Protein, Human (HEK293, His)

Decorin/PGS2 Protein, Human (HEK 293, His) expresses in HEK293 with a His tag at the N-terminus. Decorin, an extracellular matrix (ECM) protein, belongs to the small leucine-rich proteoglycan family. Decorin acts as a ligand of various cytokines and growth factors by directly or indirectly interacting with the corresponding signalling molecules involved in cell growth, differentiation, proliferation, adhesion and metastasis^[1].

Two main themes for Decorin functions have emerged: maintenance of cellular structure and regulation of signal transduction pathways, culminating in anti-tumourigenic effects^[1].

Measured in a cell proliferation assay using A549 mouse fibroblast cells. The ED₅₀ for this effect is ≤0.295 μg/mL, corresponding to a specific activity is ≥3.390×10³ U/mg.

• 
  Measured in a cell proliferation assay using A549 mouse fibroblast cells. The ED₅₀ for this effect is 0.295 μg/mL, corresponding to a specific activity is 3.390×10³ U/mg.

Human

HEK293

C-6*His

P07585-1 (G17-K359)

1634  [NCBI]

GPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

approximately 45-55 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Wen Zhang, et al. Decorin is a pivotal effector in the extracellular matrix and tumour microenvironment. Oncotarget. 2018 Jan 3;9(4):5480-5491.  [Content Brief]