DEFA1 Protein, Human (GST)

The DEFA1 protein is a multifunctional effector in innate immunity that exhibits antibiotic-like properties against bacteria, fungi, and viruses. It promotes immune defense by activating antigen-presenting cells (APCs) and inhibiting bacterial cell wall synthesis by interacting with lipid II. DEFA1 Protein, Human (GST) is the recombinant human-derived DEFA1 protein, expressed by E. coli , with N-GST labeled tag. The total length of DEFA1 Protein, Human (GST) is 94 a.a., with molecular weight of ~34 kDa.

The DEFA1 Protein serves as a versatile effector within the innate immune system, wielding antibiotic-like properties against a diverse range of infectious agents, encompassing bacteria, fungi, and viruses. Additionally, DEFA1 contributes to immune defense by promoting the activation and maturation of antigen-presenting cells (APCs). Through interaction with the vital precursor of cell wall synthesis, lipid II, DEFA1 inhibits bacterial cell wall synthesis. It further impedes adenovirus infection by restraining viral disassembly at the vertex region, hindering the release of the internal capsid protein pVI crucial for endosomal membrane penetration during cell entry. The protein's interaction with adenovirus capsid redirects viral particles to TLR4, promoting a NLRP3-mediated inflammasome response and interleukin-1 beta (IL-1beta) release. DEFA1 induces the production of proinflammatory cytokines, including type I interferon, in plasmacytoid dendritic cells (pDCs) by triggering NFKBIA degradation and nuclear translocation of IRF1, both pivotal for pDC activation. Structurally, DEFA1 exists as both a tetramer and a dimer, illustrating its dynamic organization, and it interacts with RETN.

Human

E. coli

N-GST

P59665 (D1-C94)

1667  [NCBI]

DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

Approximately 34 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.