DEFA1 Protein, Human (GST)
Based on 1 publication(s) in Google Scholar
The DEFA1 protein is a multifunctional effector in innate immunity that exhibits antibiotic-like properties against bacteria, fungi, and viruses. It promotes immune defense by activating antigen-presenting cells (APCs) and inhibiting bacterial cell wall synthesis by interacting with lipid II. DEFA1 Protein, Human (GST) is the recombinant human-derived DEFA1 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The DEFA1 protein is a multifunctional effector in innate immunity that exhibits antibiotic-like properties against bacteria, fungi, and viruses. It promotes immune defense by activating antigen-presenting cells (APCs) and inhibiting bacterial cell wall synthesis by interacting with lipid II. DEFA1 Protein, Human (GST) is the recombinant human-derived DEFA1 protein, expressed by E. coli , with N-GST labeled tag.
Background
The DEFA1 Protein serves as a versatile effector within the innate immune system, wielding antibiotic-like properties against a diverse range of infectious agents, encompassing bacteria, fungi, and viruses. Additionally, DEFA1 contributes to immune defense by promoting the activation and maturation of antigen-presenting cells (APCs). Through interaction with the vital precursor of cell wall synthesis, lipid II, DEFA1 inhibits bacterial cell wall synthesis. It further impedes adenovirus infection by restraining viral disassembly at the vertex region, hindering the release of the internal capsid protein pVI crucial for endosomal membrane penetration during cell entry. The protein's interaction with adenovirus capsid redirects viral particles to TLR4, promoting a NLRP3-mediated inflammasome response and interleukin-1 beta (IL-1beta) release. DEFA1 induces the production of proinflammatory cytokines, including type I interferon, in plasmacytoid dendritic cells (pDCs) by triggering NFKBIA degradation and nuclear translocation of IRF1, both pivotal for pDC activation. Structurally, DEFA1 exists as both a tetramer and a dimer, illustrating its dynamic organization, and it interacts with RETN.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Biochem Biophys Rep
Human neutrophil defensin-1 binding increases histidine kinase activity of SaeS in Staphylococcus aureus. [Abstract]2025 Mar 21:42:101982. PMID: 40207086
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P59665 (M1-C94)
-
Molecular Construction
-
N-term
-
GST
-
DEFA1 (M1-C94)
Accession # P59665 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
DEFA1; Neutrophil Defensin 1; Prev. DEFA2; Defensin, Alpha 1; Prev. DEF1; HP-1; Prev. MRS; HP1; HNP-1; Myeloid-Related Sequence; Defensin, Alpha 1, Myeloid-Related Sequence; Defensin Alpha 1; Defensin, Alpha 2
-
AA Sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
-
Predicted Molecular Mass
37.2 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)