1. Recombinant Proteins
  2. Receptor Proteins
  3. Notch family
  4. Delta-like 3 (DLL3)
  5. Delta-like protein 3/DLL3 Protein, Rhesus Macaque (HEK293, His)

Delta-like protein 3/DLL3 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P77642
Handling Instructions Technical Support

Delta-like protein 3 (DLL3), also known as Delta-like protein 3, is a protein that lacks conserved residues required for propagation of feature annotations. Missing residues in DLL3 prevent the propagation of specific functional features associated with this protein. Delta-like protein 3/DLL3 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Delta-like protein 3/DLL3 protein, expressed by HEK293 , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Delta-like protein 3 (DLL3), also known as Delta-like protein 3, is a protein that lacks conserved residues required for propagation of feature annotations. Missing residues in DLL3 prevent the propagation of specific functional features associated with this protein. Delta-like protein 3/DLL3 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Delta-like protein 3/DLL3 protein, expressed by HEK293 , with N-His labeled tag.

Background

Delta-like protein 3 (DLL3), also known as Delta-like protein 3, is a protein that lacks conserved residues required for propagation of feature annotations. The missing residues in DLL3 hinder the propagation of specific functional features associated with this protein. DLL3 is a member of the Delta/Serrate/Lag-2 (DSL) family of Notch ligands and plays a key role in the Notch signaling pathway, which is involved in a variety of cellular processes such as cell fate determination and tissue development. The exact meaning of the defective residues in DLL3 and the potential impact on DLL3-mediated Notch signaling require further investigation.

Species

Rhesus Macaque

Source

HEK293

Tag

N-12*His

Accession

F6TFV4 (A27-R490)

Gene ID

/

Molecular Construction
N-term
12*His
DLL3 (A27-R490)
Accession # F6TFV4
C-term
Protein Length

Partial

Synonyms
Delta3; DLL3; Pudgy; SCDO1; SCDO1delta3
AA Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPEAPAPDLPLPNGLLQVPFRDAWPGTFSLIIETWREELGDQIGGPAWSLLARVTRRRRLAAGGPWARDIQRAGAWELRFSYRARCELLAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPPVCRAGCSLEHGFCEQPGECRCLEGWTGPLCTVPASTSSCLGLRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPGSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHNLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGSRCEFPVHPDGVSALPAAPPGLRPGDPQR

Predicted Molecular Mass
51 kDa
분자량

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Delta-like protein 3/DLL3 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Delta-like protein 3/DLL3 Protein, Rhesus Macaque (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Delta-like protein 3/DLL3 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P77642
수량:
MCE Japan Authorized Agent: