1. Recombinant Proteins
  2. Others
  3. DERP5 Protein, Dermatophagoides pteronyssinus (His)

DERP5 Protein, Dermatophagoides pteronyssinus (His)

Cat. No.: HY-P77351
SDS COA Handling Instructions

DERP5 protein exhibits a monomeric structure and forms homodimeric trimers through concentration-dependent oligomerization, which plays a key role in allergic reactions. Multiple population studies have shown that DERP5 binds to IgE and is associated with mite allergy symptoms such as asthma and rhinitis. DERP5 Protein, Dermatophagoides pteronyssinus (His) is the recombinant DERP5 protein, expressed by E. coli , with N-His labeled tag. The total length of DERP5 Protein, Dermatophagoides pteronyssinus (His) is 132 a.a., with molecular weight of ~16.6 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DERP5 protein exhibits a monomeric structure and forms homodimeric trimers through concentration-dependent oligomerization, which plays a key role in allergic reactions. Multiple population studies have shown that DERP5 binds to IgE and is associated with mite allergy symptoms such as asthma and rhinitis. DERP5 Protein, Dermatophagoides pteronyssinus (His) is the recombinant DERP5 protein, expressed by E. coli , with N-His labeled tag. The total length of DERP5 Protein, Dermatophagoides pteronyssinus (His) is 132 a.a., with molecular weight of ~16.6 KDa.

Background

The DERP5 protein exhibits a monomeric structure and further forms a trimer of homodimers, oligomerizing in a concentration-dependent manner. Notably, DERP5 is implicated in causing allergic reactions in humans, with common symptoms of mite allergy including bronchial asthma, allergic rhinitis, and conjunctivitis. It binds to IgE in individuals allergic to house dust mite (HDM), as evidenced by various studies. Recombinant DERP5 protein demonstrates IgE binding in a significant percentage of patients tested across different populations. Moreover, skin tests with the recombinant protein result in positive reactions in patients with asthma and allergic rhinitis. Importantly, DERP5 does not exhibit relevant cross-reactivity with the Der p 21 allergen. Additionally, DERP5 induces histamine release from human peripheral blood mononuclear leukocytes and up-regulates the expression of the CD203c activation marker on basophils. These findings underscore DERP5's role in allergic responses and its potential significance in understanding and managing mite-induced allergic conditions.

Species

Others

Source

E. coli

Tag

N-His

Accession

P14004 (M1-V132)

Gene ID

113793750  [NCBI]

Molecular Construction
N-term
His
DERP5 (M1-V132)
Accession # P14004
C-term
Synonyms
Mite allergen Der p 5; Allergen Der p V; IgE-binding allergen; Der p 5
AA Sequence

MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDLKKEEARVKKIEV

Molecular Weight

Approximately 15 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DERP5 Protein, Dermatophagoides pteronyssinus (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DERP5 Protein, Dermatophagoides pteronyssinus (His)
Cat. No.:
HY-P77351
Quantity:
MCE Japan Authorized Agent: