DERP5 Protein, Dermatophagoides pteronyssinus (His)
Based on 1 Customer Validation
DERP5 protein exhibits a monomeric structure and forms homodimeric trimers through concentration-dependent oligomerization, which plays a key role in allergic reactions. Multiple population studies have shown that DERP5 binds to IgE and is associated with mite allergy symptoms such as asthma and rhinitis. DERP5 Protein, Dermatophagoides pteronyssinus (His) is the recombinant DERP5 protein, expressed by E. coli , with N-His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
DERP5 protein exhibits a monomeric structure and forms homodimeric trimers through concentration-dependent oligomerization, which plays a key role in allergic reactions. Multiple population studies have shown that DERP5 binds to IgE and is associated with mite allergy symptoms such as asthma and rhinitis. DERP5 Protein, Dermatophagoides pteronyssinus (His) is the recombinant DERP5 protein, expressed by E. coli , with N-His labeled tag.
Background
The DERP5 protein exhibits a monomeric structure and further forms a trimer of homodimers, oligomerizing in a concentration-dependent manner. Notably, DERP5 is implicated in causing allergic reactions in humans, with common symptoms of mite allergy including bronchial asthma, allergic rhinitis, and conjunctivitis. It binds to IgE in individuals allergic to house dust mite (HDM), as evidenced by various studies. Recombinant DERP5 protein demonstrates IgE binding in a significant percentage of patients tested across different populations. Moreover, skin tests with the recombinant protein result in positive reactions in patients with asthma and allergic rhinitis. Importantly, DERP5 does not exhibit relevant cross-reactivity with the Der p 21 allergen. Additionally, DERP5 induces histamine release from human peripheral blood mononuclear leukocytes and up-regulates the expression of the CD203c activation marker on basophils. These findings underscore DERP5's role in allergic responses and its potential significance in understanding and managing mite-induced allergic conditions.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-His
-
Accession
P14004 (M1-V132)
-
Gene ID113793750 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
DERP5 (M1-V132)
Accession # P14004 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Mite allergen Der p 5; Allergen Der p V; IgE-binding allergen; Der p 5
-
AA Sequence
MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDLKKEEARVKKIEV
-
Molecular Weight
Approximately 15 kDa.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)