1. Recombinant Proteins
  2. Viral Proteins
  3. Ebola Virus Proteins
  4. Ebola Virus GP Proteins
  5. Ebola virus Glycoprotein/GP-RBD Protein (ACI28624, HEK293, Fc)

Ebola virus Glycoprotein/GP-RBD Protein (ACI28624, HEK293, Fc)

Cat. No.: HY-P76882
Handling Instructions Technical Support

Ebola virus glycoprotein (GP1), as a receptor-binding subunit, plays a key role in the virus entry process. During late stages of infection, GP1 downregulates key host cell surface molecules, including integrins such as ITGA1-6, disrupting adhesion and potentially leading to disruption of vascular integrity. Ebola virus Glycoprotein/GP-RBD Protein (ACI28624, HEK293, Fc) is the recombinant Virus-derived Ebola virus Glycoprotein/GP protein RBD, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Ebola virus glycoprotein (GP1), as a receptor-binding subunit, plays a key role in the virus entry process. During late stages of infection, GP1 downregulates key host cell surface molecules, including integrins such as ITGA1-6, disrupting adhesion and potentially leading to disruption of vascular integrity. Ebola virus Glycoprotein/GP-RBD Protein (ACI28624, HEK293, Fc) is the recombinant Virus-derived Ebola virus Glycoprotein/GP protein RBD, expressed by HEK293 , with C-hFc labeled tag.

Background

The trimeric GP1,2 complexes of the Ebola virus Glycoprotein (GP) play a pivotal role in viral entry processes, where GP1 serves as the receptor-binding subunit and GP2 acts as the membrane fusion subunit. In the later stages of infection, GP1 down-regulates the expression of crucial host cell surface molecules involved in immune surveillance and cell adhesion. This includes the modulation of integrins such as ITGA1, ITGA2, ITGA3, ITGA4, ITGA5, ITGA6, ITGAV, and ITGB1, potentially leading to cell detachment and contributing to the disruption of blood vessel integrity, resulting in hemorrhages during infection (cytotoxicity). Additionally, GP1 interacts with host TLR4, stimulating the differentiation and activation of monocytes, leading to bystander death of T-lymphocytes. It further down-regulates the function of host natural killer cells and counteracts the antiviral effect of host BST2/tetherin, which restricts the release of progeny virions from infected cells. Interestingly, GP1 cooperates with VP40 and host BST2 to activate the canonical NF-kappa-B pathway in a manner dependent on neddylation. Furthermore, GP1 functions as a decoy for anti-GP1,2 antibodies, contributing to viral immune evasion, and interacts with host macrophages and dendritic cells, inducing the up-regulation of cytokine transcription, with this effect mediated through the activation of host TLR4.

Species

Virus

Source

HEK293

Tag

C-hFc

Accession

ACI28624.1 (I33-V308)

Gene ID

9487265  [NCBI]

Molecular Construction
N-term
EBOV GP-RBD (I33-V308)
Accession # ACI28624.1
hFc
C-term
Protein Length

Partial

Synonyms
Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein / GP-RBD Protein (Fc)
AA Sequence

IPLGVVHNNTLQVSDIDKLVCRDKLSSTSQLKSVGLNLEGNGVATDVPTATKRWGFRAGVPPKVVNYEAGEWAENCYNLDIKKADGSECLPEAPEGVRGFPRCRYVHKVSGTGPCPEGYAFHKEGAFFLYDRLASTIIYRSTTFSEGVVAFLILPETKKDFFQSPPLHEPANMTTDPSSYYHTVTLNYVADNFGTNMTNFLFQVDHLTYVQLEPRFTPQFLVQLNETIYTNGRRSNTTGTLIWKVNPTVDTGVGEWAFWENKKNFTKTLSSEELSV

Predicted Molecular Mass
57.6 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

Ebola virus Glycoprotein/GP-RBD Protein (ACI28624, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Ebola virus Glycoprotein/GP-RBD Protein (ACI28624, HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ebola virus Glycoprotein/GP-RBD Protein (ACI28624, HEK293, Fc)
Cat. No.:
HY-P76882
Quantity:
MCE Japan Authorized Agent: