Ebola virus Glycoprotein/GP2 Protein (AHX24649, HEK293, Fc)

Ebola virus glycoproteins (GPs) play a key role in the virus entry process, with GP1 serving as the receptor-binding subunit and GP2 for membrane fusion. GP downregulates host cell surface molecules, disrupts adhesion and may lead to disruption of vascular integrity. Ebola virus Glycoprotein/GP2 Protein (AHX24649, HEK293, Fc) is the recombinant Virus-derived Ebola virus Glycoprotein/GP2 protein, expressed by HEK293 , with N-mFc labeled tag.

The trimeric GP1,2 complexes of the Ebola virus Glycoprotein (GP) play a crucial role in viral entry processes, where GP1 serves as the receptor-binding subunit and GP2 acts as the membrane fusion subunit. During later stages of infection, GP down-regulates the expression of various host cell surface molecules, including integrins such as ITGA1, ITGA2, ITGA3, ITGA4, ITGA5, ITGA6, ITGAV, and ITGB1, disrupting cell adhesion and contributing to the detachment of cells, potentially leading to blood vessel integrity disruption and hemorrhages. GP also interacts with host TLR4, stimulating the differentiation and activation of monocytes, resulting in bystander death of T-lymphocytes. Additionally, GP counteracts the antiviral effect of host BST2/tetherin, cooperates with VP40 and host BST2 to activate the canonical NF-kappa-B pathway, and functions as a decoy for anti-GP1,2 antibodies, contributing to viral immune evasion. Moreover, GP interacts with and activates host macrophages and dendritic cells, inducing the up-regulation of cytokine transcription through the activation of host TLR4.

Virus

HEK293

N-mFc

AHX24649 (E502-Q650)

/

Partial

EVIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPDQGDNDNWWTGWRQ

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.