Ebola virus VP40/Matrix VP40 Protein (Q5XX06, His)

Ebola virus VP40 (matrix VP40 protein) centrally directs virus assembly and budding and has complex interactions with viral ribonucleocapsid and host ESCRT proteins (VPS4, PDCD6IP/ALIX, NEDD4, TGS101). Ebola virus VP40/Matrix VP40 Protein (Q5XX06, His) is the recombinant Virus-derived Ebola virus VP40/Matrix VP40 protein, expressed by E. coli , with N-His labeled tag.

The Ebola virus VP40, also known as Matrix VP40 protein, plays a central role in virus particle assembly and budding, orchestrating intricate interactions with both viral and host components. It functions by interacting with the viral ribonucleocapsid and members of the host ESCRT system, including VPS4, PDCD6IP/ALIX, NEDD4, or TGS101, essential for efficient budding. Additionally, its association with the host E3 ubiquitin ligase SMURF2 facilitates virus budding. Notably, VP40 may contribute to immune cell dysfunction by being packaged into exosomes, diminishing the viability of recipient cells through RNAi suppression and exosome-bystander apoptosis. Existing in various oligomeric forms, such as homodimers, homohexamers critical for budding, and homooctamers involved in genome replication and RNA binding, VP40 undergoes dynamic structural transitions upon reorganization at the plasma membrane into a hexameric form using phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2). These hexamers are crucial for the budding process, while octamers play a role in genome replication and RNA binding. VP40 further interacts with host factors including TSG101, NEDD4, PDCD6IP/ALIX, SMURF2, ITCH, and nucleoprotein/NP, highlighting its pivotal role in governing virus assembly and egress.

Virus

E. coli

N-His

Q5XX06 (V31-K326)

3160775  [NCBI]

Partial

VSGIQQKQEVLPGMDTPSNSMRPVADDNIDHTSHTPNGVASAFILEATVNVISGPKVLMKQIPIWLPLGIADQKTYSFDSTTAAIMLASYTITHFGKANNPLVRVNRLGQGIPDHPLRLLRMGNQAFLQEFVLPPVQLPQYFTFDLTALKLVTQPLPAATWTDETPSNLSGALRPGLSFHPKLRPVLLPGKTGKKGHVSDLTAPDKIQTIVNLMQDFKIVPIDPAKSIIGIEVPELLVHKLTGKKMSQKNGQPIIPVLLPKYIGLDPISPGDLTMVITPDYDDCHSPASCSYLSEK

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.