ECH1 Protein, Human (His)

Cat. No.: HY-P70059: Ficha de datos
COA

SDS
Instrucciones de manejo
FAQs
Technical Support

ECH1 Protein plays a crucial role in isomerization, converting 3-trans,5-cis-dienoyl-CoA to its isomeric form, 2-trans,4-trans-dienoyl-CoA. This enzymatic step is vital in metabolic pathways, ensuring the equilibrium of dienoyl-CoA species and contributing to overall metabolic flux. ECH1's activity is essential for maintaining structural rearrangement in Coenzyme A (CoA)-linked intermediates, emphasizing its significance in cellular processes. ECH1 Protein, Human (His) is the recombinant human-derived ECH1 protein, expressed by E. coli , with N-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Tamaño	Stock	Cantidad
10 μg	En stock	Estimated Time of Arrival: December 31
50 μg	En stock	Estimated Time of Arrival: December 31
100 μg	Obtener un presupuesto

or Consulta para venta a granel

* Seleccione Cantidad antes de agregar artículos.

1 Publications Citing Use of MCE ECH1 Protein, Human (His)

•J Immunol Res. 2022 May 6;2022:3351268. [Abstract]

Actividad biológica
Technical Parameters
Properties
Descripciòn

Descripciòn	ECH1 Protein plays a crucial role in isomerization, converting 3-trans,5-cis-dienoyl-CoA to its isomeric form, 2-trans,4-trans-dienoyl-CoA. This enzymatic step is vital in metabolic pathways, ensuring the equilibrium of dienoyl-CoA species and contributing to overall metabolic flux. ECH1's activity is essential for maintaining structural rearrangement in Coenzyme A (CoA)-linked intermediates, emphasizing its significance in cellular processes. ECH1 Protein, Human (His) is the recombinant human-derived ECH1 protein, expressed by E. coli , with N-6*His labeled tag.
Background	ECH1 plays a crucial role in the enzymatic process of isomerization, specifically converting 3-trans,5-cis-dienoyl-CoA into its isomeric form, 2-trans,4-trans-dienoyl-CoA. This isomerization step is essential in various metabolic pathways where Coenzyme A (CoA)-linked intermediates undergo structural rearrangement. ECH1's ability to catalyze this isomeric transformation contributes to the overall metabolic flux, highlighting its significance in maintaining the equilibrium of dienoyl-CoA species in cellular processes.
Actividad biológica	The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Species	Human
Source	E. coli
Tag	N-6*His
Accession	Q13011 (T34-L328)
Gene ID	1891 [NCBI]
Molecular Construction	N-term 6*His ECH1 (T34-L328) Accession # Q13011 C-term
Protein Length	Full Length of Mature Protein
Synonyms	rHuDelta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial/ECH1, His; Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase; mitochondrial; ECH1;
AA Sequence	TGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Peso molecular	30-35 kDa
Pureza	≥ 95%, as determined by reducing SDS-PAGE.
Appearance	Solution.
Formulation	Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 8% trehalose, 0.05% Tween 80, pH 8.5. Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	N/A.
Storage & Stability	Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Envío	Shipping with dry ice.
Documentación	Select Batch: Ficha de datos (236 KB) SDS (251 KB) COA (219 KB) Instrucciones de manejo (2659 KB)