Ecotin Protein, E. coli (His)

Customer Review

Based on 1 Customer Validation

Ecotin, a bacterial protein inhibitor, regulates serine proteases like trypsin and subtilisin. Ecotin's unique surface loop forms a stable complex, influencing enzymatic activity. Ecotin Protein, E. coli (His) is the recombinant E. coli-derived Ecotin protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Ecotin, a bacterial protein inhibitor, regulates serine proteases like trypsin and subtilisin. Ecotin's unique surface loop forms a stable complex, influencing enzymatic activity. Ecotin Protein, E. coli (His) is the recombinant E. coli-derived Ecotin protein, expressed by E. coli , with C-His labeled tag.

Background

Ecotin is a protein inhibitor that regulates protease activity in bacteria. It specifically inhibits several serine proteases, including trypsin and subtilisin. This regulatory role allows bacteria to control protease-mediated processes, impacting various cellular functions. Ecotin's interaction with proteases involves a unique surface loop that forms a stable complex, influencing enzymatic activity. This protein plays a crucial role in bacterial physiology and is of interest in studying protease inhibition mechanisms.

Verified Bioactivity

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC50 value is <1.4 nM.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Ecotin (A21-R162)
      Accession # NP_416713
    • His
    • C-term
  • Protein Length

    Full Length of Ecotin Chain

  • Synonyms

    CILK1; Laryngeal Cancer Kinase 2; Prev. ICK; HICK; LCK2; Non-Specific Serine/Threonine Protein Kinase; MRK; Iciliogenesis Associated Kinase 1; Serine/Threonine-Protein Kinase ICK; Serine/Threonine Protein Kinase; Intestinal Cell Kinase; EJM10; MAK-Related

  • AA Sequence

    AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of Tris and NaCl or 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00