EDA2R/XEDAR Protein, Cynomolgus (HEK293, Fc)

EDA2R Protein, also known as EDA-2R and TNFRSF27, is a transmembrane protein in the TNF receptor superfamily. EDA2R Protein is widely expressed, notably in embryonic basal epidermal cells and maturing hair follicles, and it does not contain a cytoplasmic death domain. EDA2R Protein can associate with Fas and induce EDA-A2 dependent apoptosis. EDA2R/XEDAR Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-hFc labeled tag.

EDA2R Protein plays a role in EDA‑A2 induced skeletal muscle degeneration and osteoblast differentiation. Its transcription is directly induced by p53, and it mediated cell death is p53 dependent^[1][2][3].

Cynomolgus

HEK293

C-hFc

NP_001180396.1 (M1-E136)

102116506  [NCBI]

Partial

MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQEQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQE

Approximately 116 kDa & 58 kDa & 53 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.