EDA2R/XEDAR Protein, Human (HEK293, His)
Based on 1 Customer Validation
The EDA2R/XEDAR protein acts as a receptor for the EDA isoform A2 (unlike A1) and is critical for activating the NF-kappa-B and JNK pathways. Its activation involves binding to TRAF3 and TRAF6. EDA2R/XEDAR Protein, Human (HEK293, His) is the recombinant human-derived EDA2R/XEDAR protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The EDA2R/XEDAR protein acts as a receptor for the EDA isoform A2 (unlike A1) and is critical for activating the NF-kappa-B and JNK pathways. Its activation involves binding to TRAF3 and TRAF6. EDA2R/XEDAR Protein, Human (HEK293, His) is the recombinant human-derived EDA2R/XEDAR protein, expressed by HEK293 , with N-His labeled tag.
Background
EDA2R/XEDAR Protein serves as a receptor specifically for EDA isoform A2, distinguishing it from isoform A1. This receptor plays a crucial role in mediating the activation of the NF-kappa-B and JNK pathways. The activation process appears to be facilitated through the binding of EDA2R/XEDAR to TRAF3 and TRAF6. Additionally, EDA2R/XEDAR forms associations with TRAF1, TRAF3, and TRAF6, indicating its involvement in intricate signaling networks. These interactions highlight the multifaceted role of EDA2R/XEDAR in cellular signaling pathways, emphasizing its potential impact on immune responses and inflammatory processes.
Verified Bioactivity
Immobilized Recombinant Human EDA-A2 at 1 μg/mL (100 μL/well) can bind Recombinant Human EDA2R. The ED50 for this effect is 216.4 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
Q9HAV5 (M1-T138)
-
Molecular Construction
-
N-term
-
His
-
EDA2R (M1-T138)
Accession # Q9HAV5 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
EDA2R; Tumor Necrosis Factor Receptor Superfamily Member 27; Ectodysplasin A2 Receptor; X-Linked Ectodysplasin-A2 Receptor; TNFRSF27; X-Linked EDA Receptor; XEDAR; EDA-A2 Receptor; EDA-A2R; Tumor Necrosis Factor Receptor Superfamily Member XEDAR; EDAA2R
-
AA Sequence
MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADTPTVPPQEAT
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
