1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. EDA2R
  6. EDA2R/XEDAR Protein, Human (HEK293, His)

EDA2R/XEDAR Protein, Human (HEK293, His)

Cat. No.: HY-P75728
COA Handling Instructions

The EDA2R/XEDAR protein acts as a receptor for the EDA isoform A2 (unlike A1) and is critical for activating the NF-kappa-B and JNK pathways. Its activation involves binding to TRAF3 and TRAF6. EDA2R/XEDAR Protein, Human (HEK293, His) is the recombinant human-derived EDA2R/XEDAR protein, expressed by HEK293 , with N-His labeled tag. The total length of EDA2R/XEDAR Protein, Human (HEK293, His) is 138 a.a., with molecular weight of ~23-25 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $30 In-stock
10 μg $75 In-stock
50 μg $180 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EDA2R/XEDAR protein acts as a receptor for the EDA isoform A2 (unlike A1) and is critical for activating the NF-kappa-B and JNK pathways. Its activation involves binding to TRAF3 and TRAF6. EDA2R/XEDAR Protein, Human (HEK293, His) is the recombinant human-derived EDA2R/XEDAR protein, expressed by HEK293 , with N-His labeled tag. The total length of EDA2R/XEDAR Protein, Human (HEK293, His) is 138 a.a., with molecular weight of ~23-25 kDa.

Background

EDA2R/XEDAR Protein serves as a receptor specifically for EDA isoform A2, distinguishing it from isoform A1. This receptor plays a crucial role in mediating the activation of the NF-kappa-B and JNK pathways. The activation process appears to be facilitated through the binding of EDA2R/XEDAR to TRAF3 and TRAF6. Additionally, EDA2R/XEDAR forms associations with TRAF1, TRAF3, and TRAF6, indicating its involvement in intricate signaling networks. These interactions highlight the multifaceted role of EDA2R/XEDAR in cellular signaling pathways, emphasizing its potential impact on immune responses and inflammatory processes.

Biological Activity

Immobilized Recombinant Human EDA-A2 at 1 μg/mL (100 μL/well) can bind Recombinant Human EDA2R. The ED50 for this effect is 216.4 ng/mL.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

Q9HAV5 (M1-T138)

Gene ID
Molecular Construction
N-term
His
EDA2R (M1-T138)
Accession # Q9HAV5
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 27; EDA-A2 receptor; EDA2R; TNFRSF27; XEDAR
AA Sequence

MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADTPTVPPQEA

Molecular Weight

Approximately 23-25 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EDA2R/XEDAR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EDA2R/XEDAR Protein, Human (HEK293, His)
Cat. No.:
HY-P75728
Quantity:
MCE Japan Authorized Agent: