EDA2R/XEDAR Protein, Rat (HEK293, His)

The EDA2R/XEDAR proteins lack conserved residues critical for feature annotation propagation and exhibit unique characteristics that raise questions about their structural and functional aspects. This uniqueness suggests potential changes in molecular interactions and signaling pathways. EDA2R/XEDAR Protein, Rat (HEK293, His) is the recombinant rat-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-His labeled tag. The total length of EDA2R/XEDAR Protein, Rat (HEK293, His) is 136 a.a., with molecular weight of ~24 KDa.

EDA2R, also known as XEDAR, presents a distinctive feature as it lacks conserved residue(s) necessary for the propagation of feature annotation. This unique characteristic raises intriguing questions about the structural and functional aspects of EDA2R, hinting at potential variations in its molecular interactions and signaling pathways. The absence of these conserved residues highlights the need for in-depth investigations to elucidate the specific roles and regulatory mechanisms associated with EDA2R, shedding light on its contributions to cellular processes and biological functions.

Immobilized Recombinant Rat EDA2R at 0.1 μg/mL (100 μL/well) can bind Recombinant Human EDA-A2. The ED₅₀ for this effect is 14.16 ng/mL.

Rat

HEK293

C-His

D3ZAX4 (M2-E137)

296872  [NCBI]

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAYCIACPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDTHTLPPKE

Approximately 24 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.