EDAR Protein, Human (HEK293, His)

EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Human (HEK293, His) is the recombinant human-derived EDAR protein, expressed by HEK293 , with C-His labeled tag. The total length of EDAR Protein, Human (HEK293, His) is 163 a.a., with molecular weight of ~25-35 kDa.

EDAR serves as a receptor specifically for EDA isoform A1, distinguishing it from EDA isoform A2. Upon binding, EDAR facilitates the activation of NF-kappa-B and JNK signaling pathways, potentially leading to various cellular responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. The receptor forms a complex with EDARADD, and it is associated with key signaling molecules such as TRAF1, TRAF2, TRAF3, and NIK, indicating its involvement in intricate signaling cascades.

When Recombinant Human EDAR Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti- EDAR Antibody. The ED₅₀ for this effect is 66.07 ng/mL.

• 
  When Recombinant Human EDAR Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti- EDAR Antibody. The ED₅₀ for this effect is 66.07 ng/mL.

Human

HEK293

C-His

Q9UNE0 (E27-I189)

10913  [NCBI]

EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGHLATALI

The protein migrates as an approximately 25-35 kDa band under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.