1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Endothelin Receptor
  5. Endothelin R Type B (EDNRB)
  6. EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc)

EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc)

Cat. No.: HY-P74181
Handling Instructions Technical Support

EDNRB/Endothelin R Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, activates a phosphatidylinositol-calcium second messenger system through G proteins. This mechanism underscores its pivotal role in mediating cellular responses initiated by endothelin neuropeptides, emphasizing the versatility of EDNRB in transducing signals for various physiological processes. EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc) is the recombinant human-derived EDNRB/Endothelin R Type B protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EDNRB/Endothelin R Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, activates a phosphatidylinositol-calcium second messenger system through G proteins. This mechanism underscores its pivotal role in mediating cellular responses initiated by endothelin neuropeptides, emphasizing the versatility of EDNRB in transducing signals for various physiological processes. EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc) is the recombinant human-derived EDNRB/Endothelin R Type B protein, expressed by HEK293 , with C-mFc labeled tag.

Background

EDNRB/Endothelin R Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, operates by associating with G proteins to activate a phosphatidylinositol-calcium second messenger system. This molecular interaction mechanism underscores its pivotal role in mediating the cellular responses initiated by endothelin neuropeptides, highlighting the versatility of EDNRB in transducing signals that contribute to various physiological processes.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

P24530 (E27-K101)

Gene ID
Molecular Construction
N-term
EDNRB (E27-K101)
Accession # P24530
mFc
C-term
Protein Length

Extracellular Domain

Synonyms
EDNRB; Endothelin receptor non-selective type; endothelin receptor type B; ETRB
AA Sequence

EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK

Predicted Molecular Mass
34.4 kDa
Molecular Weight

Approximately 47.5 kDa & 43.7 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc)
Cat. No.:
HY-P74181
Quantity:
MCE Japan Authorized Agent: