2. Recombinant Proteins
  3. Receptor Proteins
  4. G-Protein-Coupled Receptors (GPCRs)
  5. Endothelin Receptor
  6. Endothelin R Type B (EDNRB)
  7. EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc)

EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc)

Cat. No.: HY-P74181
Handling Instructions Technical Support

EDNRB/Endothelin R Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, activates a phosphatidylinositol-calcium second messenger system through G proteins. This mechanism underscores its pivotal role in mediating cellular responses initiated by endothelin neuropeptides, emphasizing the versatility of EDNRB in transducing signals for various physiological processes. EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc) is the recombinant human-derived EDNRB/Endothelin R Type B protein, expressed by HEK293 , with C-mFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

EDNRB/Endothelin R Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, activates a phosphatidylinositol-calcium second messenger system through G proteins. This mechanism underscores its pivotal role in mediating cellular responses initiated by endothelin neuropeptides, emphasizing the versatility of EDNRB in transducing signals for various physiological processes. EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc) is the recombinant human-derived EDNRB/Endothelin R Type B protein, expressed by HEK293 , with C-mFc labeled tag.
Background

EDNRB/Endothelin R Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, operates by associating with G proteins to activate a phosphatidylinositol-calcium second messenger system. This molecular interaction mechanism underscores its pivotal role in mediating the cellular responses initiated by endothelin neuropeptides, highlighting the versatility of EDNRB in transducing signals that contribute to various physiological processes.
Species

Human
Source

HEK293
Tag

C-mFc
Accession

P24530 (E27-K101)
Gene ID
Molecular Construction
N-term
EDNRB (E27-K101)
Accession # P24530
mFc
C-term
Protein Length

Extracellular Domain
Synonyms
EDNRB; Endothelin receptor non-selective type; endothelin receptor type B; ETRB
AA Sequence

EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK

Predicted Molecular Mass
34.4 kDa
분자량

Approximately 47.5 kDa & 43.7 kDa,based on SDS-PAGE under reducing conditions.
Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
각종 서류
Handling Instructions (2659 KB)

EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc)

  

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

도

Country or Region *

      

비고

대량구매 문의

Inquiry Information

상품명:
EDNRB/Endothelin R Type B Protein, Human (HEK293, Fc)
Cat. No.:
HY-P74181
수량:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

상품명

  

Lot #

고객명 *

 

Country or Region *

메일주소 *

     

전화번호 *

 

회사명 *

비고

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.