EIF5A Protein, Human (His)
Based on 1 Customer Validation
The GSK-3 beta protein is an enzyme that plays a crucial role in multiple cellular processes, including cell proliferation, differentiation, and apoptosis. It regulates various signaling pathways and is involved in the development of several diseases, such as cancer and neurodegenerative disorders. GSK-3 beta is active in its unphosphorylated form and can phosphorylate a wide range of substrates to modulate cellular functions. EIF5A Protein, Human (His) is the recombinant human-derived EIF5A protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GSK-3 beta protein is an enzyme that plays a crucial role in multiple cellular processes, including cell proliferation, differentiation, and apoptosis. It regulates various signaling pathways and is involved in the development of several diseases, such as cancer and neurodegenerative disorders. GSK-3 beta is active in its unphosphorylated form and can phosphorylate a wide range of substrates to modulate cellular functions. EIF5A Protein, Human (His) is the recombinant human-derived EIF5A protein, expressed by E. coli , with N-6*His labeled tag.
Background
The EIF5A Protein is characterized by its ability to enable U6 snRNA binding activity and protein N-terminus binding activity. It plays a role in diverse cellular processes, including the cellular response to viruses, positive regulation of the intrinsic apoptotic signaling pathway by p53 class mediator, and the tumor necrosis factor-mediated signaling pathway. The protein is found in annulate lamellae, cytoplasm, and the nucleus, with a specific association with the nuclear pore. Notably, the EIF5A gene demonstrates ubiquitous expression, with elevated levels detected in the esophagus (RPKM 53.8), appendix (RPKM 49.4), and 25 other tissues, suggesting its involvement in various physiological contexts across a broad spectrum of tissues. [Information provided by Alliance of Genome Resources, April 2022]
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
NP_001961 (M1-K154)
-
Molecular Construction
-
N-term
-
6*His
-
EIF5A (M1-K154)
Accession # NP_001961 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EIF5A; EIF-4D; Eukaryotic Translation Initiation Factor 5A; Eukaryotic Initiation Factor 5A Isoform 1; EIF-5A; Eukaryotic Initiation Factor 5A; EIF5A1; EIF-5A-1; Eukaryotic Translation Initiation Factor 5A-1; EIF-5A1; Rev-Binding Factor; EIF5AI; MGC104255
-
AA Sequence
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
-
Predicted Molecular Mass
16.8 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
