1. Recombinant Proteins
  2. Others
  3. EIF5A Protein, Human (His)

EIF5A Protein, Human (His)

Cat. No.: HY-P78232
COA Handling Instructions

The GSK-3 beta protein is an enzyme that plays a crucial role in multiple cellular processes, including cell proliferation, differentiation, and apoptosis. It regulates various signaling pathways and is involved in the development of several diseases, such as cancer and neurodegenerative disorders. GSK-3 beta is active in its unphosphorylated form and can phosphorylate a wide range of substrates to modulate cellular functions. EIF5A Protein, Human (His) is the recombinant human-derived EIF5A protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF5A Protein, Human (His) is 154 a.a., with molecular weight of ~19 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $75 In-stock
10 μg $125 In-stock
50 μg $355 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GSK-3 beta protein is an enzyme that plays a crucial role in multiple cellular processes, including cell proliferation, differentiation, and apoptosis. It regulates various signaling pathways and is involved in the development of several diseases, such as cancer and neurodegenerative disorders. GSK-3 beta is active in its unphosphorylated form and can phosphorylate a wide range of substrates to modulate cellular functions. EIF5A Protein, Human (His) is the recombinant human-derived EIF5A protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF5A Protein, Human (His) is 154 a.a., with molecular weight of ~19 kDa.

Background

The EIF5A Protein is characterized by its ability to enable U6 snRNA binding activity and protein N-terminus binding activity. It plays a role in diverse cellular processes, including the cellular response to viruses, positive regulation of the intrinsic apoptotic signaling pathway by p53 class mediator, and the tumor necrosis factor-mediated signaling pathway. The protein is found in annulate lamellae, cytoplasm, and the nucleus, with a specific association with the nuclear pore. Notably, the EIF5A gene demonstrates ubiquitous expression, with elevated levels detected in the esophagus (RPKM 53.8), appendix (RPKM 49.4), and 25 other tissues, suggesting its involvement in various physiological contexts across a broad spectrum of tissues. [Information provided by Alliance of Genome Resources, April 2022]

Species

Human

Source

E. coli

Tag

N-6*His

Accession

NP_001961 (M1-K154)

Gene ID
Molecular Construction
N-term
6*His
EIF5A (M1-K154)
Accession # NP_001961
C-term
Synonyms
Eukaryotic translation initiation factor 5A-1; eIF-5A1; Rev-binding factor; eIF-4D
AA Sequence

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Molecular Weight

Approximately 19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For lower concentration,please reconstitute in 50 mM Tris-HCL,300 mM NaCl, pH 7.4 buffer.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EIF5A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF5A Protein, Human (His)
Cat. No.:
HY-P78232
Quantity:
MCE Japan Authorized Agent: