EN1 Protein, Gallus gallus (His-B2M)
EN1 Protein is essential for the correct formation of the apical ectodermal ridge and accurate dorsal-ventral patterning in the limb. EN1 Protein, Gallus gallus (His-B2M) is the recombinant EN1 protein, expressed by E. coli , with N-6*His, B2M labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EN1 Protein is essential for the correct formation of the apical ectodermal ridge and accurate dorsal-ventral patterning in the limb. EN1 Protein, Gallus gallus (His-B2M) is the recombinant EN1 protein, expressed by E. coli , with N-6*His, B2M labeled tag.
Background
EN1 plays a pivotal role in embryonic development, specifically contributing to the proper formation of the apical ectodermal ridge and ensuring accurate dorsal-ventral patterning in limb development.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His;B2M
-
Accession
Q05916 (M1-E333)
-
Gene ID771008 [NCBI]
-
Molecular Construction
-
N-term
-
6*His-B2M
-
EN1 (M1-333E)
Accession # Q05916 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EN1; Hu-En-1; Engrailed Homeobox 1; Engrailed Homolog 1; Homeobox Protein Engrailed-1; ENDOVESLB; Homeobox Protein En-1
-
AA Sequence
MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE
-
Predicted Molecular Mass
48.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
