Enterotoxin type B Protein, S. aureus (P.pastoris, His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

Enterotoxin B (SEB) is an antigen derived from Staphylococcus aureus (S. aureus) that can be recognized and bound by MHC class II molecules on antigen-presenting cells. Enterotoxin B also interacts with T cell receptors (TCRs), triggering massive activation of CD4+ and CD8+ T cells, leading to the release of proinflammatory cytokines (TNF-α, IFN-γ) and Th2-type cytokines (IL-4, IL-5, IL-13), regulating inflammatory responses. Enterotoxin B also exerts anti-tumor potential in fibrosarcoma models, inducing tumor necrosis. Enterotoxin type B Protein, S. aureus (P.pastoris, His) is a recombinant Enterotoxin B protein expressed by P. pastoris yeast with N-6*His tag.

For research use only. We do not sell to patients.
  • Species: Staphylococcus aureus
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Enterotoxin B (SEB) is an antigen derived from Staphylococcus aureus (S. aureus) that can be recognized and bound by MHC class II molecules on antigen-presenting cells. Enterotoxin B also interacts with T cell receptors (TCRs), triggering massive activation of CD4+ and CD8+ T cells, leading to the release of proinflammatory cytokines (TNF-α, IFN-γ) and Th2-type cytokines (IL-4, IL-5, IL-13), regulating inflammatory responses. Enterotoxin B also exerts anti-tumor potential in fibrosarcoma models, inducing tumor necrosis. Enterotoxin type B Protein, S. aureus (P.pastoris, His) is a recombinant Enterotoxin B protein expressed by P. pastoris yeast with N-6*His tag.

Background

Enterotoxin type B, S. aureus is a superantigen of enterotoxin B (SEB) derived from Staphylococcus aureus (S. aureus), which belongs to the staphylococcal enterotoxin family. Enterotoxin B structurally binds to MHC class II molecules on antigen presenting cells and binds to the variable region of the β chain of the T cell receptor (TCR), activating T cells expressing a specific (Vβ)-TCR fragment. Enterotoxin B-TCR triggers massive activation of CD4+ and CD8+ T cells, leading to the release of proinflammatory cytokines (TNF-α, IFN-γ) and Th2-type cytokines (IL-4, IL-5, IL-13), and mediates the synthesis of nitric oxide (NO) through TNF and IFN-γ. The activity of enterotoxin B involves a regulatory loop in which NO downregulates cytokine production to prevent excessive inflammation. Enterotoxin B has been shown to induce TH2-biased cytokine release in a nasal polyp model; in an endotoxin shock model, NO-mediated protection against lethal cytokine storm was observed. In addition, intravenous administration of Enterotoxin B enhanced IFN-γ production and CD4+/CD8+ T cell infiltration, demonstrated anti-tumor potential in a fibrosarcoma model, and induced tumor necrosis.

In Vivo

Enterotoxin type B Protein, S. aureus (100 μg; intraperitoneal injection; 1 time; single dose) can induce a large amount of NO synthesis in the mouse endotoxin shock model. The synthesis of NO is regulated by TNF and IFN-γ. At the same time, endogenous NO can downregulate the production of TNF and IFN-γ and play a protective role. Inhibition of NO synthesis will lead to the death of mice, while neutralization of IFN-γ and TNF can reduce the mortality of mice[1].
Enterotoxin type B Protein, S. aureus (10 ng; intravenous injection; once every 3 days; 2 weeks) can significantly inhibit the tumor growth of the mouse fibrosarcoma model, increase the IFN-γ level and CD4+/CD8+ T cell infiltration rate, and induce tumor tissue necrosis, while intratumoral injection has no obvious tumor inhibition effect[2].

Verified Bioactivity

Measured by its ability to induce IL-10 secretion by Raji cells. The ED50 for this effect is 53.25 ng/mL, corresponding to a specific activity is 1.878×10^4 U/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL-10 secretion by Raji cells. The ED50 for this effect is 53.25 ng/mL, corresponding to a specific activity is 1.878×10^4 U/mg.

Technical Parameters

  • Species Staphylococcus aureus
  • Source P. pastoris
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • SEB (E28-K266)
      Accession # P01552
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Enterotoxin type B; SEB; entB

  • AA Sequence

    ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

  • Predicted Molecular Mass

    30.4 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00