Enterotoxin type B Protein, S. aureus (P.pastoris, His)

Enterotoxins (SEBs) activate the host immune system by binding raw molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules. The formation of the ternary complex triggers significant activation of T lymphocytes, leading to the systemic release of pro-inflammatory cytokines. Enterotoxin type B Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Enterotoxin type B protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Enterotoxin type B Protein, S. aureus (P.pastoris, His) is 239 a.a., with molecular weight of ~30.4 kDa.

Enterotoxin type B (SEB) is a staphylococcal enterotoxin known for activating the host immune system by binding as unprocessed molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules. The formation of this ternary complex leads to the activation of a substantial number of T-lymphocytes, initiating a systemic release of pro-inflammatory cytokines. Additionally, SEB is implicated in the development of staphylococcal food poisoning syndrome. SEB interacts specifically with MHC class II molecules, composed of alpha/HLA-DRA and beta/HLA-DRB1 chains, as well as with T-cell receptor beta variable 19/TRBV19. These interactions underscore its role in immune system activation and associated pathological responses.

Staphylococcus aureus

P. pastoris

N-6*His

P01552 (E28-K266)

/

ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

Approximately 30.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.