Enterotoxin type C-2 Protein, S. aureus
Enterotoxin type C-2 (SEC2) activates the host immune system by binding the unprocessed molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type C-2 Protein, S. aureus is the recombinant Staphylococcus aureus-derived Enterotoxin type C-2 protein, expressed by E. coli , with tag free.
- Species: Staphylococcus aureus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Enterotoxin type C-2 (SEC2) activates the host immune system by binding the unprocessed molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type C-2 Protein, S. aureus is the recombinant Staphylococcus aureus-derived Enterotoxin type C-2 protein, expressed by E. coli , with tag free.
Background
Enterotoxin type C-2 (SEC2) is a staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex, which subsequently activates a substantial number of T-lymphocytes, initiating a widespread release of pro-inflammatory cytokines. Additionally, SEC2 is implicated in the development of staphylococcal food poisoning syndrome, a condition characterized by symptoms such as gastrointestinal distress and systemic illness.
Technical Parameters
-
Species Staphylococcus aureus
-
Source E. coli
-
Tag Tag Free
-
Accession
P34071 (E28-G266)
-
Gene ID/
-
Molecular Construction
-
N-term
-
SEC2 (E28-G266)
Accession # P34071 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Enterotoxin type C-2; SEC2; entC2
-
AA Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
-
Predicted Molecular Mass
27.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
