Enterotoxin type C-2 Protein, S. aureus

Enterotoxin type C-2 (SEC2) activates the host immune system by binding the unprocessed molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type C-2 Protein, S. aureus is the recombinant Staphylococcus aureus-derived Enterotoxin type C-2 protein, expressed by E. coli , with tag free. The total length of Enterotoxin type C-2 Protein, S. aureus is 239 a.a., with molecular weight of ~27.6 kDa.

Enterotoxin type C-2 (SEC2) is a staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex, which subsequently activates a substantial number of T-lymphocytes, initiating a widespread release of pro-inflammatory cytokines. Additionally, SEC2 is implicated in the development of staphylococcal food poisoning syndrome, a condition characterized by symptoms such as gastrointestinal distress and systemic illness.

Staphylococcus aureus

E. coli

Tag Free

P34071 (28E-266G)

/

ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Approximately 27.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.