Enterotoxin type H Protein, S. aureus (P.pastoris, His)

Enterotoxin (ETH) activates the host immune system by binding as a raw molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules, specifically through its alpha domain, specifically TRAV27 . This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type H Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Enterotoxin type H protein, expressed by P. pastoris , with N-His labeled tag. The total length of Enterotoxin type H Protein, S. aureus (P.pastoris, His) is 217 a.a., with molecular weight of ~27.1 kDa.

Enterotoxin type H (ETH) is a staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules, notably through their alpha domain, particularly TRAV27. This interaction forms a ternary complex that, in turn, triggers the activation of a substantial number of T-lymphocytes, initiating a widespread release of pro-inflammatory cytokines. Additionally, ETH is implicated in the development of staphylococcal food poisoning syndrome, a condition characterized by symptoms such as high fever, hypotension, diarrhea, shock, and, in severe cases, potential fatality.

Staphylococcus aureus

P. pastoris

N-His

P0A0M0 (25E-241V)

/

EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Approximately 27.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.