1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. Epithelial Cell Adhesion Molecule (EpCAM) Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD326/EpCAM
  5. EpCAM/TROP1 Protein, Rhesus Macaque (HEK293)

EpCAM/TROP1 proteins play key roles in multiple processes as homogeneous interacting molecules that facilitate communication between mucosal epithelial midgut epithelial cells (IECs) and intraepithelial lymphocytes (IELs) to establish immunity against mucosal infections force. EpCAM/TROP1 Protein, Rhesus Macaque (HEK293) is the recombinant Rhesus Macaque-derived EpCAM/TROP1 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EpCAM/TROP1 proteins play key roles in multiple processes as homogeneous interacting molecules that facilitate communication between mucosal epithelial midgut epithelial cells (IECs) and intraepithelial lymphocytes (IELs) to establish immunity against mucosal infections force. EpCAM/TROP1 Protein, Rhesus Macaque (HEK293) is the recombinant Rhesus Macaque-derived EpCAM/TROP1 protein, expressed by HEK293 , with tag free.

Background

EpCAM/TROP1 protein functions as a crucial player in multiple biological processes. It serves as a physical homophilic interaction molecule, facilitating communication between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) within the mucosal epithelium, thereby establishing an immunological barrier as the initial defense against mucosal infections. EpCAM/TROP1 also plays a crucial role in regulating the proliferation and differentiation of embryonic stem cells. Additionally, it is involved in the up-regulation of FABP5, MYC, and cyclins A and E, potentially influencing cell cycle progression. EpCAM/TROP1 exists as a monomer and interacts with phosphorylated CLDN7, further highlighting its diverse functional repertoire.

Biological Activity

Immobilized Rhesus macaque/Cynomolgus EpCAM, No Tag at 2 μg/mL (100μl/well) on the plate. Dose response curve for Anti-EpCAM Antibody, hFc Tag with the EC50 of 71.8 ng/mL determined by ELISA.

Species

Rhesus Macaque

Source

HEK293

Tag

Tag Free

Accession

Q1WER1/NP_001035118.1 (Q24-K265)

Gene ID
Molecular Construction
N-term
EpCAM (Q24-K265)
Accession # Q1WER1/NP_001035118.1
C-term
Protein Length

Extracellular Domain

Synonyms
Epithelial cell adhesion molecule; Ep-CAM; EGP; KSA; CD326; TROP2
AA Sequence

QKECVCENYKLAVNCFLNDNGQCQCTSIGAQNTVLCSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDVQSLRTALEEAIKTRYQLDPKFITNILYEDNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLRVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Molecular Weight

35-45 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EpCAM/TROP1 Protein, Rhesus Macaque (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EpCAM/TROP1 Protein, Rhesus Macaque (HEK293)
Cat. No.:
HY-P75736
Quantity:
MCE Japan Authorized Agent: