1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Endothelial cell CD Proteins
  4. CD201/Activated Protein C Receptor
  5. EPCR Protein, Mouse (HEK293, His)

EPCR Protein, Mouse (HEK293, His)

Cat. No.: HY-P75245
COA Handling Instructions

EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis. EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag. The total length of EPCR Protein, Mouse (HEK293, His) is 197 a.a., with molecular weight of 30-48 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $95 In-stock
50 μg $240 In-stock
100 μg $380 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis. EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag. The total length of EPCR Protein, Mouse (HEK293, His) is 197 a.a., with molecular weight of 30-48 kDa.

Background

The EPCR protein plays a crucial role in the protein C pathway, which regulates blood coagulation. It has the capability to bind activated protein C and acts to enhance its activation by the thrombin-thrombomodulin complex. This interaction is essential for controlling blood coagulation and maintaining proper hemostasis.

Biological Activity

Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Mouse EPCR. The ED50 for this effect is 0.4145 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q64695 (L18-S214)

Gene ID

19124  [NCBI]

Molecular Construction
N-term
EPCR (L18-S214)
Accession # Q64695
His
C-term
Synonyms
Endothelial Protein C Receptor; CD201; PROCR; EPCR
AA Sequence

LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS

Molecular Weight

Approximately 30-48 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EPCR Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EPCR Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75245
Quantity:
MCE Japan Authorized Agent: