EPCR Protein, Mouse (HEK293, His)

EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.

The EPCR protein plays a crucial role in the protein C pathway, which regulates blood coagulation. It has the capability to bind activated protein C and acts to enhance its activation by the thrombin-thrombomodulin complex. This interaction is essential for controlling blood coagulation and maintaining proper hemostasis.

Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Mouse EPCR. The ED₅₀ for this effect is 0.4145 μg/mL.

• 
  Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Mouse EPCR. The ED₅₀ for this effect is 0.4145 μg/mL.

Mouse

HEK293

C-6*His

Q64695 (L18-S214)

19124  [NCBI]

Extracellular Domain

LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS

Approximately 30-48 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.