1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Endothelial cell CD Proteins
  4. CD201/Activated Protein C Receptor
  5. EPCR Protein, Mouse (HEK293, His)

EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.

Background

The EPCR protein plays a crucial role in the protein C pathway, which regulates blood coagulation. It has the capability to bind activated protein C and acts to enhance its activation by the thrombin-thrombomodulin complex. This interaction is essential for controlling blood coagulation and maintaining proper hemostasis.

Biological Activity

Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Mouse EPCR. The ED50 for this effect is 0.4145 μg/mL.

  • Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Mouse EPCR. The ED50 for this effect is 0.4145 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q64695 (L18-S214)

Gene ID
Molecular Construction
N-term
EPCR (L18-S214)
Accession # Q64695
His
C-term
Protein Length

Extracellular Domain

Synonyms
Endothelial Protein C Receptor; CD201; PROCR; EPCR
AA Sequence

LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EPCR Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EPCR Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EPCR Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75245
Quantity:
MCE Japan Authorized Agent: