EPCR Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.
Background
The EPCR protein plays a crucial role in the protein C pathway, which regulates blood coagulation. It has the capability to bind activated protein C and acts to enhance its activation by the thrombin-thrombomodulin complex. This interaction is essential for controlling blood coagulation and maintaining proper hemostasis.
Verified Bioactivity
Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Mouse EPCR. The ED50 for this effect is 0.4145 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q64695 (L18-S214)
-
Molecular Construction
-
N-term
-
EPCR (L18-S214)
Accession # Q64695 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PROCR; Protein C Receptor, Endothelial; Protein C Receptor; CD201 Antigen; EPCR; APC Receptor; Endothelial Protein C Receptor; CD201; Activated Protein C Receptor; Cell Cycle, Centrosome-Associated Protein; CCD41; Centrocyclin; Endothelial Cell Protein C
-
AA Sequence
LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
