Ephrin B3 Protein, Rat (HEK293, His)

Ephrin B3 Protein, a member of the ephrin family, lacks conserved residue(s) crucial for feature annotation propagation. This unique molecular profile suggests distinct functional properties and interactions within the ephrin family. Investigating the specific role and implications of this divergence in conserved residues is crucial to understand Ephrin B3's functional nuances and cellular significance in biological processes. Ephrin B3 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin B3 Protein, Rat (HEK293, His) is 197 a.a., with molecular weight of 27-32 kDa.

Ephrin B3 protein is a member of the ephrin family and is characterized by the absence of conserved residue(s) crucial for the propagation of feature annotation. This distinctive feature suggests a unique molecular profile within the ephrin family, potentially influencing its functional properties and interactions. The specific role and implications of this divergence in conserved residues warrant further investigation to comprehend the functional nuances and cellular significance of Ephrin B3 in biological processes.

Immobilized Rat Ephrin B3 at 10μg/mL (100μL/well) can bind biotinylated Mouse EphB3, the ED₅₀ for this effect is 36.91 ng/mL.

Rat

HEK293

C-6*His

G3V7D4 (L28-S224)

360546  [NCBI]

MGGPHFGPGGVQVGALLLLGFAGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSQEPGKDSIPGDPNSNATSRGAEGPLPPPS

Approximately 27-32 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.