Ephrin B3 Protein, Mouse (HEK293, hFc)

Ephrin B3 protein, a transmembrane ligand, binds adjacent Eph receptors, triggering bidirectional signaling. It induces axon collapse in vitro and may influence axon guidance and orientation. Ephrin B3 interacts with GRIP1 and GRIP2, suggesting regulatory roles in development and cellular functions. Ephrin B3 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived Ephrin B3 protein, expressed by HEK293 , with C-hFc labeled tag.

Ephrin B3 protein, a cell surface transmembrane ligand for Eph receptors crucial in neuronal, vascular, and epithelial development, engages in contact-dependent bidirectional signaling by binding promiscuously to Eph receptors on adjacent cells. This leads to forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. With potential significance in forebrain function, Ephrin B3 binds to and induces the collapse of commissural axons/growth cones in vitro, suggesting a role in axon guidance. Additionally, it may contribute to constraining the orientation of longitudinally projecting axons. The protein interacts with GRIP1 and GRIP2, further emphasizing its involvement in intricate signaling processes and potential regulatory roles during development and cellular functions.

Mouse

HEK293

C-hFc

O35393 (L28-A227)

13643  [NCBI]

Extracellular Domain

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA

Approximately 48.8 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.