2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Ephrin/Eph Family
  5. Ephrins
  6. Ephrin-B3
  7. Ephrin B3 Protein, Rat (HEK293, Fc)

Ephrin B3 Protein, Rat (HEK293, Fc)

Cat. No.: HY-P73021
Handling Instructions

Ephrin B3 Protein, a member of the ephrin family, lacks conserved residue(s) crucial for feature annotation propagation. This unique molecular profile suggests distinct functional properties and interactions within the ephrin family. Investigating the specific role and implications of this divergence in conserved residues is crucial to understand Ephrin B3's functional nuances and cellular significance in biological processes. Ephrin B3 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin B3 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin B3 Protein, Rat (HEK293, Fc) is 224 a.a., with molecular weight of ~55 & 34 kDa, respectively.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin B3 Protein, a member of the ephrin family, lacks conserved residue(s) crucial for feature annotation propagation. This unique molecular profile suggests distinct functional properties and interactions within the ephrin family. Investigating the specific role and implications of this divergence in conserved residues is crucial to understand Ephrin B3's functional nuances and cellular significance in biological processes. Ephrin B3 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin B3 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin B3 Protein, Rat (HEK293, Fc) is 224 a.a., with molecular weight of ~55 & 34 kDa, respectively.
Background

Ephrin B3 protein is a member of the ephrin family and is characterized by the absence of conserved residue(s) crucial for the propagation of feature annotation. This distinctive feature suggests a unique molecular profile within the ephrin family, potentially influencing its functional properties and interactions. The specific role and implications of this divergence in conserved residues warrant further investigation to comprehend the functional nuances and cellular significance of Ephrin B3 in biological processes.
Species

Rat
Source

HEK293
Tag

C-hFc
Accession

G3V7D4 (M1-S224)
Gene ID

360546  [NCBI]
Molecular Construction
N-term
Ephrin B3 (M1-S224)
Accession # G3V7D4
hFc
C-term
Synonyms
Ephrin-B3; EPH-related receptor tyrosine kinase ligand 8; LERK-8; EFNB3; EPLG8
AA Sequence

MGGPHFGPGGVQVGALLLLGFAGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSQEPGKDSIPGDPNSNATSRGAEGPLPPPS

Molecular Weight

Approximately 55&34 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Ephrin B3 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin B3 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73021
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.