Copy Link Print Information

Ephrin B3 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Ephrin B3 protein, a transmembrane ligand, binds adjacent Eph receptors, triggering bidirectional signaling. It induces axon collapse in vitro and may influence axon guidance and orientation. Ephrin B3 interacts with GRIP1 and GRIP2, suggesting regulatory roles in development and cellular functions. Ephrin B3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Ephrin B3 Protein, Mouse (HEK293, His)
  • Ephrin B3 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Ephrin B3 protein, a transmembrane ligand, binds adjacent Eph receptors, triggering bidirectional signaling. It induces axon collapse in vitro and may influence axon guidance and orientation. Ephrin B3 interacts with GRIP1 and GRIP2, suggesting regulatory roles in development and cellular functions. Ephrin B3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Ephrin B3 protein, a cell surface transmembrane ligand for Eph receptors crucial in neuronal, vascular, and epithelial development, engages in contact-dependent bidirectional signaling by binding promiscuously to Eph receptors on adjacent cells. This leads to forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. With potential significance in forebrain function, Ephrin B3 binds to and induces the collapse of commissural axons/growth cones in vitro, suggesting a role in axon guidance. Additionally, it may contribute to constraining the orientation of longitudinally projecting axons. The protein interacts with GRIP1 and GRIP2, further emphasizing its involvement in intricate signaling processes and potential regulatory roles during development and cellular functions.

Verified Bioactivity

Immobilized mouse EFNB3-His at 10μg/mL (100μL/well) can bind biotinylated mouse EPHB3, the ED50 for this effect is 0.5188 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    O35393 (L28-A227)

  • Gene ID
    13643  [NCBI]
  • Molecular Construction
    • N-term
    • Ephrin B3 (L28-A227)
      Accession # O35393
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    EFNB3; LERK-8; Prev. EPLG8; LERK8; EPH-Related Receptor Tyrosine Kinase Ligand 8; EFL6; Ephrin-B3; Ephrin B3; EPH-Related Receptor Transmembrane Ligand ELK-L3

  • AA Sequence

    LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Ephrin B3 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Ephrin B3 Protein, Mouse (HEK293, His)
  • Ephrin B3 Protein, Mouse (HEK293, His) Product Image