1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Erythropoietin/EPO Protein, Human (CHO)

Erythropoietin/EPO is a renal cytokine that activates Akt and NF-κB signaling pathways by binding to erythroid progenitor cells EPOR. Erythropoietin/EPO regulates erythroid proliferation and differentiation and inhibits apoptosis. Erythropoietin/EPO also has angiogenic ability comparable to VEGF and can stimulate endothelial cell capillary sprouting. Erythropoietin/EPO can be used in the study of ischemic heart diseases such as anemia in end-stage renal disease. Erythropoietin/EPO Protein, Human (CHO) is a recombinant Erythropoietin/EPO protein expressed in CHO cells with tag-free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

2 Publications Citing Use of MCE Erythropoietin/EPO Protein, Human (CHO)

WB
IF
ELISA
Flow Cytometry

    Erythropoietin/EPO Protein, Human (CHO) purchased from MCE. Usage Cited in: Int Immunopharmacol. 2025 Dec 16:169:116053.  [Abstract]

    Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1-9 U/g; s.c.; once daily) upregulated the expression of EPOR in the hippocampus of septic rats. Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1 U/g) induced an additional increase of βCR, whereas high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (9 U/g) displayed a significant decrease in βCR expression.

    Erythropoietin/EPO Protein, Human (CHO) purchased from MCE. Usage Cited in: Int Immunopharmacol. 2025 Dec 16:169:116053.  [Abstract]

    Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1-9 U/g; s.c.; once daily) significantly increased βCR expression and the number of Iba1+βCR+ cells in the hippocampus of septic rats compared to the CLP group, while high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) significantly decreased them.

    Erythropoietin/EPO Protein, Human (CHO) purchased from MCE. Usage Cited in: Int Immunopharmacol. 2025 Dec 16:169:116053.  [Abstract]

    Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1-1 μg/mL; 12 h). Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1 μg/mL) significantly inhibited IL-6 release and enhanced IL-10 expression in microglial cells, while high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1 μg/mL) exhibited the opposite trend.

    Erythropoietin/EPO Protein, Human (CHO) purchased from MCE. Usage Cited in: Int Immunopharmacol. 2025 Dec 16:169:116053.  [Abstract]

    Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1-1 μg/mL; 12 h). Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) enhanced βCR and EPOR expression levels in BV2 cells. In contrast, high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) decreased βCR expression while exerting no significant effect on EPOR expression.

    Erythropoietin/EPO Protein, Human (CHO) purchased from MCE. Usage Cited in: Int Immunopharmacol. 2025 Dec 16:169:116053.  [Abstract]

    Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1-1 μg/mL; 12 h). Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) decreased the proportion of Iba1+CD86+ (M1 phenotype) cells while increasing that of Iba1+CD206+ (M2 phenotype) cells. However, high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) significantly promoted the M1 polarization of microglia but did not significantly affect the M2 microglia population.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    Erythropoietin/EPO is a renal cytokine that activates Akt and NF-κB signaling pathways by binding to erythroid progenitor cells EPOR. Erythropoietin/EPO regulates erythroid proliferation and differentiation and inhibits apoptosis. Erythropoietin/EPO also has angiogenic ability comparable to VEGF and can stimulate endothelial cell capillary sprouting. Erythropoietin/EPO can be used in the study of ischemic heart diseases such as anemia in end-stage renal disease. Erythropoietin/EPO Protein, Human (CHO) is a recombinant Erythropoietin/EPO protein expressed in CHO cells with tag-free.

    Background

    Erythropoietin/EPO is a glycoprotein mainly produced by the kidney and belongs to the cytokine superfamily. Erythropoietin/EPO binds to the erythropoietin receptor (EPOR) on erythroid progenitor cells (CFU-E and BFU-E), activates signaling pathways such as Akt and NF-κB, regulates erythrocyte proliferation and differentiation, promotes cell survival and inhibits apoptosis. Erythropoietin/EPO also has pro-angiogenic potential comparable to VEGF, can stimulate endothelial cell capillary sprouting, and protect tissues from ischemia-reperfusion injury by reducing apoptosis and inflammation. Clinically, recombinant human Erythropoietin/EPO (rh-EPO) can be used to study the inhibition of anemia in end-stage renal disease, and has potential application value in ischemic heart disease, nervous system damage and therapeutic angiogenesis.

    Biological Activity

    The ED50 is <3 ng/mL as measured in a cell proliferation assay using TF-1 human erythroleukemic cells, corresponding to a specific activity of >3.33× 105 units/mg.

    • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.136 ng/mL, corresponding to a specific activity is 8.803×105 U/mg
    Species

    Human

    Source

    CHO

    Tag

    Tag Free

    Accession

    P01588 (A28-R193)

    Gene ID
    Molecular Construction
    N-term
    EPO (A28-R193)
    Accession # P01588
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rHuEPO; Epoetin; EPO
    AA Sequence

    APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

    Predicted Molecular Mass
    18.4 kDa
    Molecular Weight

    Approximately 26-36 kDa, based on SDS-PAGE under reducing conditions.

    Glycosylation
    Yes
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    Erythropoietin/EPO Protein, Human (CHO) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Erythropoietin/EPO Protein, Human (CHO)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    Erythropoietin/EPO Protein, Human (CHO)
    Cat. No.:
    HY-P7164
    Quantity:
    MCE Japan Authorized Agent: