ETS1/EWSR2 Protein, Human (His)

ETS1/EWSR2 Protein, a transcription factor, directly regulates cytokine and chemokine gene expression in diverse cellular contexts. It controls lymphoid cell differentiation, survival, and proliferation, possibly impacting angiogenesis by regulating genes controlling endothelial cell migration and invasion. Additionally, it acts as a dominant-negative for isoform c-ETS-1A. ETS1/EWSR2 Protein, Human (His) is the recombinant human-derived ETS1/EWSR2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ETS1/EWSR2 Protein, Human (His) is 272 a.a., with molecular weight of ~36 kDa.

ETS1/EWSR2 protein, a transcription factor, exerts direct control over the expression of cytokine and chemokine genes across diverse cellular contexts. Its regulatory influence extends to the differentiation, survival, and proliferation of lymphoid cells, emphasizing its pivotal role in immune-related processes. Moreover, ETS1/EWSR2 is implicated in the modulation of angiogenesis, orchestrating the expression of genes that govern endothelial cell migration and invasion. Additionally, this protein serves as a dominant-negative factor for isoform c-ETS-1A, further highlighting its intricate regulatory functions in cellular processes and immune responses.

Data is not available.

Human

E. coli

N-6*His

P14921-5 (M1-T272)

2113  [NCBI]

MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT

Approximately 36 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.