Copy Link Print Information

ETS1/EWSR2 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

ETS1/EWSR2 Protein, a transcription factor, directly regulates cytokine and chemokine gene expression in diverse cellular contexts. It controls lymphoid cell differentiation, survival, and proliferation, possibly impacting angiogenesis by regulating genes controlling endothelial cell migration and invasion. Additionally, it acts as a dominant-negative for isoform c-ETS-1A. ETS1/EWSR2 Protein, Human (His) is the recombinant human-derived ETS1/EWSR2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for ETS1/EWSR2 Protein, Human (His)
  • ETS1/EWSR2 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ETS1/EWSR2 Protein, a transcription factor, directly regulates cytokine and chemokine gene expression in diverse cellular contexts. It controls lymphoid cell differentiation, survival, and proliferation, possibly impacting angiogenesis by regulating genes controlling endothelial cell migration and invasion. Additionally, it acts as a dominant-negative for isoform c-ETS-1A. ETS1/EWSR2 Protein, Human (His) is the recombinant human-derived ETS1/EWSR2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

ETS1/EWSR2 protein, a transcription factor, exerts direct control over the expression of cytokine and chemokine genes across diverse cellular contexts. Its regulatory influence extends to the differentiation, survival, and proliferation of lymphoid cells, emphasizing its pivotal role in immune-related processes. Moreover, ETS1/EWSR2 is implicated in the modulation of angiogenesis, orchestrating the expression of genes that govern endothelial cell migration and invasion. Additionally, this protein serves as a dominant-negative factor for isoform c-ETS-1A, further highlighting its intricate regulatory functions in cellular processes and immune responses.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P14921-5 (M1-T272)

  • Gene ID
    2113  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • ETS1 (M1-T272)
      Accession # P14921-5
    • C-term
  • Protein Length

    Full Length of Isoform-5

  • Synonyms

    ETS1; FLJ10768; Prev. EWSR2; V-Ets Avian Erythroblastosis Virus E2 Oncogene Homolog 1; ETS-1; ETS1 Protein; Avian Erythroblastosis Virus E26 (V-Ets) Oncogene Homolog-1; Ets Protein; V-Ets Avian Erythroblastosis Virus E26 Oncogene Homolog 1; C-Ets-1; Prote

  • AA Sequence

    MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 1 mM EDTA, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • ETS1/EWSR2 Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for ETS1/EWSR2 Protein, Human (His)
  • ETS1/EWSR2 Protein, Human (His) Product Image