1. Recombinant Proteins
  2. Others
  3. FABP5/E-FABP Protein, Mouse (His)

FABP5/E-FABP Protein, Mouse (His)

Cat. No.: HY-P79398
COA Handling Instructions

FABP5, also known as E-FABP, acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. In addition to cytoplasmic transport, it selectively transports fatty acids to the nucleus, activates nuclear receptors, and delivers retinoic acid to promote proliferation. FABP5/E-FABP Protein, Mouse (His) is the recombinant mouse-derived FABP5/E-FABP protein, expressed by E. coli , with N-6*His labeled tag. The total length of FABP5/E-FABP Protein, Mouse (His) is 135 a.a., with molecular weight of ~16 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $69 In-stock
10 μg $116 In-stock
50 μg $325 In-stock
100 μg $553 In-stock
500 μg $1550 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FABP5, also known as E-FABP, acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. In addition to cytoplasmic transport, it selectively transports fatty acids to the nucleus, activates nuclear receptors, and delivers retinoic acid to promote proliferation. FABP5/E-FABP Protein, Mouse (His) is the recombinant mouse-derived FABP5/E-FABP protein, expressed by E. coli , with N-6*His labeled tag. The total length of FABP5/E-FABP Protein, Mouse (His) is 135 a.a., with molecular weight of ~16 kDa.

Background

FABP5, also known as E-FABP, functions as an intracellular carrier for long-chain fatty acids and related active lipids, including endocannabinoids, thereby regulating the metabolism and actions of the ligands they bind. Beyond its role in cytosolic transport, FABP5 selectively delivers specific fatty acids from the cytosol to the nucleus, activating nuclear receptors. Notably, it delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5's involvement extends to serving as a synaptic carrier of endocannabinoids at central synapses, thereby controlling retrograde endocannabinoid signaling. Additionally, FABP5 modulates inflammation by regulating PTGES induction through NF-kappa-B activation and prostaglandin E2 (PGE2) biosynthesis during inflammatory processes. Its potential role in keratinocyte differentiation is also suggested.

Biological Activity

Data is not available.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q05816 (M1-Q135)

Gene ID

16592  [NCBI]

Molecular Construction
N-term
6*His
FABP5 (M1-Q135)
Accession # Q05816
C-term
Synonyms
Fatty acid-binding protein 5; Fabp5; Epidermal-type fatty acid-binding protein; E-FABP; Fatty acid-binding protein, epidermal; Keratinocyte lipid-binding protein; Psoriasis-associated fatty acid-binding protein homolog; PA-FABP; Fabpe; Klbp; Mal1
AA Sequence

MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ

Molecular Weight

Approximately 16 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FABP5/E-FABP Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FABP5/E-FABP Protein, Mouse (His)
Cat. No.:
HY-P79398
Quantity:
MCE Japan Authorized Agent: