FABP5 Protein, Mouse (His)
Based on 1 Customer Validation
FABP5, also known as E-FABP, acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism.In addition to cytoplasmic transport, it selectively transports fatty acids to the nucleus, activates nuclear receptors, and delivers retinoic acid to promote proliferation.FABP5 Protein, Mouse (His) is the recombinant mouse-derived FABP5 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FABP5, also known as E-FABP, acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism.In addition to cytoplasmic transport, it selectively transports fatty acids to the nucleus, activates nuclear receptors, and delivers retinoic acid to promote proliferation.FABP5 Protein, Mouse (His) is the recombinant mouse-derived FABP5 protein, expressed by E.coli , with N-6*His labeled tag.
FABP5, also known as E-FABP, functions as an intracellular carrier for long-chain fatty acids and related active lipids, including endocannabinoids, thereby regulating the metabolism and actions of the ligands they bind. Beyond its role in cytosolic transport, FABP5 selectively delivers specific fatty acids from the cytosol to the nucleus, activating nuclear receptors. Notably, it delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5's involvement extends to serving as a synaptic carrier of endocannabinoids at central synapses, thereby controlling retrograde endocannabinoid signaling. Additionally, FABP5 modulates inflammation by regulating PTGES induction through NF-kappa-B activation and prostaglandin E2 (PGE2) biosynthesis during inflammatory processes. Its potential role in keratinocyte differentiation is also suggested.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q05816 (M1-Q135)
-
Molecular Construction
-
N-term
-
6*His
-
FABP5 (M1-Q135)
Accession # Q05816 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FABP5; Psoriasis-Associated Fatty Acid-Binding Protein Homolog; Fatty Acid Binding Protein 5; Epidermal-Type Fatty Acid-Binding Protein; PA-FABP; Fatty Acid-Binding Protein 5; E-FABP; Fatty Acid-Binding Protein, Epidermal; Fatty Acid Binding Protein 5 (Ps
-
AA Sequence
MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
