FAM167A Protein, Human (HEK293, Myc, His)

FAM167A protein shows significant expression in multiple tissues, including skin, spleen, kidney, leukocytes, testis, lung, small intestine, and prostate. This diverse expression pattern suggests potential roles in various physiological processes across organs and cell types. FAM167A Protein, Human (HEK293, Myc, His) is the recombinant human-derived FAM167A protein, expressed by HEK293 , with N-His, C-Myc labeled tag. The total length of FAM167A Protein, Human (HEK293, Myc, His) is 214 a.a., with molecular weight of ~28.2 kDa.

FAM167A protein is notably expressed in various tissues, including the skin (including primary keratinocytes), spleen, kidney, leukocytes, testis, lung, small intestine, and prostate. This diverse expression pattern suggests potential roles for FAM167A in a range of physiological processes across different organs and cell types. Its presence in skin, spleen, and kidney implicates it in skin biology, immune responses, and renal functions, while its expression in testis hints at involvement in reproductive processes. The wide distribution of FAM167A across multiple tissues emphasizes its potential versatility and underscores the importance of further investigation to elucidate its specific functions and contributions in different cellular contexts.

Human

HEK293

N-His;C-Myc

Q96KS9 (1M-214C)

83648  [NCBI]

MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC

Approximately 28.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.