FAM167A Protein, Human (HEK293, Myc, His)
FAM167A protein shows significant expression in multiple tissues, including skin, spleen, kidney, leukocytes, testis, lung, small intestine, and prostate. This diverse expression pattern suggests potential roles in various physiological processes across organs and cell types. FAM167A Protein, Human (HEK293, Myc, His) is the recombinant human-derived FAM167A protein, expressed by HEK293 , with N-His, C-Myc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FAM167A protein shows significant expression in multiple tissues, including skin, spleen, kidney, leukocytes, testis, lung, small intestine, and prostate. This diverse expression pattern suggests potential roles in various physiological processes across organs and cell types. FAM167A Protein, Human (HEK293, Myc, His) is the recombinant human-derived FAM167A protein, expressed by HEK293 , with N-His, C-Myc labeled tag.
Background
FAM167A protein is notably expressed in various tissues, including the skin (including primary keratinocytes), spleen, kidney, leukocytes, testis, lung, small intestine, and prostate. This diverse expression pattern suggests potential roles for FAM167A in a range of physiological processes across different organs and cell types. Its presence in skin, spleen, and kidney implicates it in skin biology, immune responses, and renal functions, while its expression in testis hints at involvement in reproductive processes. The wide distribution of FAM167A across multiple tissues emphasizes its potential versatility and underscores the importance of further investigation to elucidate its specific functions and contributions in different cellular contexts.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His;C-Myc
-
Accession
Q96KS9 (M1-C214)
-
Molecular Construction
-
N-term
-
10*His
-
FAM167A (M1-C214)
Accession # Q96KS9 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
FAM167A; Family With Sequence Similarity 167, Member A; Prev. C8orf13; Alternative Protein FAM167A; DIORA-1; FAM167A Protein; Disordered Autoimmunity 1; D8S265; Protein FAM167A; Family With Sequence Similarity 167 Member A; Chromosome 8 Open Reading Frame
-
AA Sequence
MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC
-
Predicted Molecular Mass
28.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
