FAM3B Protein, Human (HEK293, Fc)

FAM3B Protein acts as a potent inducer of apoptosis, influencing alpha and beta cells in a dose- and time-dependent manner. Its regulatory impact on programmed cell death underscores its significance, particularly within apoptosis. The specificity for alpha and beta cells suggests targeted modulation of pancreatic cell populations, implicating FAM3B in key processes related to pancreatic function and homeostasis. FAM3B Protein, Human (HEK293, Fc) is the recombinant human-derived FAM3B protein, expressed by HEK293 , with C-hFc labeled tag.

The FAM3B protein serves as a potent inducer of apoptosis, acting on both alpha and beta cells in a dose- and time-dependent manner. Its regulatory influence on programmed cell death highlights its significance in shaping cellular responses, particularly within the context of apoptosis. The specificity of this effect on alpha and beta cells suggests a targeted impact on pancreatic cell populations, potentially implicating FAM3B in the modulation of key processes related to pancreatic function and homeostasis.

Human

HEK293

C-hFc

P58499-1 (E30-S235)

54097  [NCBI]

Full Length of Isoform-1 Mature Protein

ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.