FAM3B Protein, Human (His, Myc)

FAM3B Protein acts as a potent inducer of apoptosis, influencing alpha and beta cells in a dose- and time-dependent manner. Its regulatory impact on programmed cell death underscores its significance, particularly within apoptosis. The specificity for alpha and beta cells suggests targeted modulation of pancreatic cell populations, implicating FAM3B in key processes related to pancreatic function and homeostasis. FAM3B Protein, Human (His) is the recombinant human-derived FAM3B protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

The FAM3B protein serves as a potent inducer of apoptosis, acting on both alpha and beta cells in a dose- and time-dependent manner. Its regulatory influence on programmed cell death highlights its significance in shaping cellular responses, particularly within the context of apoptosis. The specificity of this effect on alpha and beta cells suggests a targeted impact on pancreatic cell populations, potentially implicating FAM3B in the modulation of key processes related to pancreatic function and homeostasis.

Human

E. coli

C-Myc;N-10*His

P58499-1 (E30-S235)

54097  [NCBI]

Full Length of Isoform-1 Mature Protein

ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.