Fc gamma RIIA/CD32a Protein, Rat (HEK293, Fc)

The Fc gamma RIIA/CD32a protein is essential for immunoglobulin receptor binding. It regulates processes such as Fc-γ receptor signaling during phagocytosis, antibody-dependent cellular cytotoxicity, and tumor necrosis factor production. Fc gamma RIIA/CD32a Protein, Rat (HEK293, Fc) is the recombinant rat-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-hFc labeled tag.

The Fc gamma RIIA/CD32a protein plays a crucial role in enabling immunoglobulin receptor binding activity. It is involved in various processes, such as regulating the Fc-gamma receptor signaling pathway involved in phagocytosis, antibody-dependent cellular cytotoxicity, and tumor necrosis factor production. This protein is located on the cell surface and has been utilized in the study of crescentic glomerulonephritis. The human ortholog of this gene, FCGR2A, has been implicated in several diseases, including autoimmune disease, dengue disease, hematologic cancer, leukopenia, and malaria. It exhibits biased expression in multiple tissues, with notable levels in the lung and spleen, among others. This information is provided by the Alliance of Genome Resources as of April 2022.

Rat

HEK293

C-hFc

A0A8L2Q236/NP_446295 (D32-L216)

116591  [NCBI]

Partial

DRQTGDLLKAVVKRDPPWIQVLKDDTVTLTCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPVHLEVISDWLLLQTPQLVFLEGERITLRCHGWKSIQLARISFLQNGEFVSFHPYNVSYSISNANHSHSGDYYCKAYLGRTEHVSKPVTITVQGSATASTSSL

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.