1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins Fc-gamma Receptor
  4. Fc gamma RII/CD32
  5. FcγRIIB/CD32b
  6. Fc gamma RIIB/CD32b Protein, Cynomolgus (HEK293, His)

Fc gamma RIIB/CD32b Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P76800
Handling Instructions Technical Support

Fc γ RIIB/CD32b proteins exhibit low affinity as complexes or receptors that aggregate the immunoglobulin γFc region. ITIM phosphorylated by Fc γ RIIB/CD32b recruits inositol phosphatases SHIP1 and SHIP2, inhibits Ras activation, down-regulates MAPK activity, reduces PLC-γ function, and results in PKC activation. Inhibition of MAP kinase pathway and anti-apoptotic kinase Akt inhibit cell proliferation and survival. Fc gamma RIIB/CD32b Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Fc γ RIIB/CD32b proteins exhibit low affinity as complexes or receptors that aggregate the immunoglobulin γFc region. ITIM phosphorylated by Fc γ RIIB/CD32b recruits inositol phosphatases SHIP1 and SHIP2, inhibits Ras activation, down-regulates MAPK activity, reduces PLC-γ function, and results in PKC activation. Inhibition of MAP kinase pathway and anti-apoptotic kinase Akt inhibit cell proliferation and survival. Fc gamma RIIB/CD32b Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-His labeled tag.

Background

Fc γ RIIB/CD32b proteins exhibit low affinity as complexes or receptors that aggregate the immunoglobulin γFc region. It plays a key role in a variety of effects and regulatory functions, including phagocytosis of immune complexes and regulation of B-cell antibody production. Upon binding to this receptor, down-regulation of the previous state of cell activation is triggered by an antigen receptor on B cells (BCR), T cells (TCR), or another Fc receptor. The IIB1 subtype does not mediate endocytosis or phagocytosis, while the IIB2 subtype does not induce phagocytosis. Fc γ RIIB/CD32b interacts with INPP5D/SHIP1, FGR, and LYN. Fc γ RIIB/CD32b -phosphorylated ITIM recruits inositol phosphatases SHIP1 and SHIP2, inhibits Ras activation, down-regulates MAPK activity, reduces PLC-γ function, and results in PKC activation. Inhibition of MAP kinase pathway and anti-apoptotic kinase Akt inhibit cell proliferation and survival[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA.Immobilized cynoCD32B-His at 10 μg/mL (100 μl/well) can bind biotinylated human IgG1, The EC50 of biotinylated human IgG1 is 0.17-0.41 μg/mL.

Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

Q8SPW3/AAL92097.1 (A45-P217)

Gene ID
Molecular Construction
N-term
Fc gamma RIIB/CD32b (A45-P217)
Accession # Q8SPW3/AAL92097.1
His
C-term
Protein Length

Partial

Synonyms
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-b; IgG Fc Receptor II-b; CDw32; Fc-Gamma RII-b; Fc-Gamma-RIIb; FcRII-b; CD32; FCGR2B; FCG2; IGFR2
AA Sequence

AAPPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNLIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETILLRCHSWKDKPLIKVTFFQNGISKKFSHMNPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVP

Molecular Weight

28-33 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fc gamma RIIB/CD32b Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIB/CD32b Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76800
Quantity:
MCE Japan Authorized Agent: