FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
The FCGRT protein delivers passive immunity by binding to monomeric IgG and promoting its absorption from milk. It forms an FcRn-IgG complex, which is transcytosis by the intestinal epithelium and releases IgG into the bloodstream or interstitial fluid. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived FCGRT-B2M Heterodimer protein, expressed by HEK293 , with C-His labeled tag. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, His), has molecular weight of ~35 & 12 kDa, respectively.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FCGRT protein delivers passive immunity by binding to monomeric IgG and promoting its absorption from milk. It forms an FcRn-IgG complex, which is transcytosis by the intestinal epithelium and releases IgG into the bloodstream or interstitial fluid. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived FCGRT-B2M Heterodimer protein, expressed by HEK293 , with C-His labeled tag. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, His), has molecular weight of ~35 & 12 kDa, respectively.
Background
The FCGRT protein is a cell surface receptor that plays a critical role in transferring passive humoral immunity from the mother to the newborn. It accomplishes this by binding to the Fc region of monomeric immunoglobulin gamma and facilitating its selective uptake from milk. Within the intestinal epithelium, the FCGRT-B2M heterodimer binds to IgG at the apical surface, forming FcRn-IgG complexes that are transcytosed across the epithelium, releasing IgG into the bloodstream or tissue fluids. This receptor continues to contribute to effective humoral immunity throughout life by recycling IgG and prolonging its half-life in circulation. Mechanistically, the binding of monomeric IgG to FCGRT-B2M in acidic endosomes of endothelial and hematopoietic cells enables the recycling of IgG to the cell surface for release into the circulation. Additionally, the FCGRT-B2M heterodimer plays a role in regulating the homeostasis of albumin, the most abundant circulating protein, by interacting with it. The FCGRT-B2M complex consists of two subunits, p51 and p14 (equivalent to beta-2-microglobulin), forming an MHC class I-like heterodimer.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When FCRN-B2M is immobilized at 2 µg/mL (100 µL/well), can bind Biotinylated Human lgG1. The ED50 for this effect is 68.15 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Synonyms
FCGRT; Major Histocompatibility Complex Class I-Like Fc Receptor; Fc Gamma Receptor And Transporter; Neonatal Crystallizable Fc Receptor FcRn Splice Variant 6; Neonatal Fc Receptor; Neonatal Crystallizable Fc Receptor FcRn Splice Variant 5; FcRn; Neonatal
-
AA Sequence
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS&IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
-
Molecular Weight
Approximately 34-38 kDa (FCGRT) & 12-15 kDa (B2M), based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
