1. Recombinant Proteins
  2. Fc Receptors
  3. Fc Receptor-like Proteins
  4. Fc Receptor-like 5 (FCRL5)
  5. FcRH5/FcRL5 Protein, Human (106a.a, HEK293, His, Avi)

FcRH5/FcRL5 Protein, Human (106a.a, HEK293, His, Avi)

Cat. No.: HY-P703957
Handling Instructions Technical Support

FcRH5/FcRL5 Protein, potentially impacting B-cell development and differentiation in peripheral lymphoid organs, serves as a marker for B-cell stages. It may have an immunoregulatory role in marginal zone B-cells and is suggested to play a role in fertilization. FcRH5/FcRL5 Protein, Human (106a.a, HEK293, His, Avi) is the recombinant human-derived FcRH5/FcRL5 protein, expressed by HEK293, with N-Avi and N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FcRH5/FcRL5 Protein, potentially impacting B-cell development and differentiation in peripheral lymphoid organs, serves as a marker for B-cell stages. It may have an immunoregulatory role in marginal zone B-cells and is suggested to play a role in fertilization. FcRH5/FcRL5 Protein, Human (106a.a, HEK293, His, Avi) is the recombinant human-derived FcRH5/FcRL5 protein, expressed by HEK293, with N-Avi and N-His labeled tag.

Background

FcRH5/FcRL5 protein emerges as a potential participant in B-cell development and differentiation within peripheral lymphoid organs, showcasing its potential as a valuable marker for various B-cell stages. This protein may extend its influence to immunoregulation within marginal zone B-cells, suggesting a role in modulating immune responses. Additionally, there is a suggested involvement in the intricate process of fertilization, underscoring the diverse functional repertoire of FcRH5/FcRL5 beyond its conventional immunological roles. Further exploration is warranted to unravel the detailed mechanisms and implications of FcRH5/FcRL5 in these biological processes.

Species

Human

Source

HEK293

Tag

N-Avi;N-8*His

Accession

Q96RD9-1 (V745-T850)

Gene ID

83416

Molecular Construction
N-term
8*His-Avi
FcRH5/FcRL5 (V745-T850)
Accession # Q96RD9-1
C-term
Protein Length

Partial

Synonyms
FcR-like protein 5; FcRH5; FcRL5; BXMAS1; CD307; CD307e; IFGP5; IRTA2
AA Sequence

VAVPVSRPVLTLRAPGTHAAVGDLLELHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGLTANRSGPFAT

Predicted Molecular Mass
14 kDa
Molecular Weight

Approximately 25-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FcRH5/FcRL5 Protein, Human (106a.a, HEK293, His, Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FcRH5/FcRL5 Protein, Human (106a.a, HEK293, His, Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FcRH5/FcRL5 Protein, Human (106a.a, HEK293, His, Avi)
Cat. No.:
HY-P703957
Quantity:
MCE Japan Authorized Agent: