FCRL1 Protein, Mouse (Q8R4Y0-2, HEK293, His)

FCRL1 Protein, a potential activating coreceptor in B-cells, may play a role in B-cell activation and differentiation. Although the precise mechanisms are under investigation, FCRL1's presence suggests involvement in intricate signaling pathways associated with B-cell function and immune responses. FCRL1 Protein, Mouse (Q8R4Y0-2, HEK293, His) is the recombinant mouse-derived FCRL1 protein, expressed by HEK293 , with C-His labeled tag.

FCRL1, a potential activating coreceptor in B-cells, exhibits a putative role in B-cell activation and differentiation. The precise mechanisms through which FCRL1 contributes to these processes are still under investigation, but its presence suggests involvement in the intricate signaling pathways associated with B-cell function and immune responses.

Mouse

HEK293

C-His

Q8R4Y0-2 (A17-T204)

229499  [NCBI]

Partial

AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIASELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLT

Approximately 42-47 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.