FCRL1 Protein, Mouse (203a.a, HEK293, His)
Based on 1 Customer Validation
Fc receptor-like protein 1 (Fcrl1) is a cell-surface membrane protein that belongs to FCRL family. Fcrl1 is a BCR co-receptor and enhance signaling through the B cell receptor. Fcrl1 promotes B cell proliferation and calcium mobilization. Fcrl1 is a biomarker and an important target in B cell lymphoproliferative disorders. FCRL1 Protein, Mouse (203a.a, HEK293, His) is the recombinant mouse-derived FCRL1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Fc receptor-like protein 1 (Fcrl1) is a cell-surface membrane protein that belongs to FCRL family. Fcrl1 is a BCR co-receptor and enhance signaling through the B cell receptor. Fcrl1 promotes B cell proliferation and calcium mobilization. Fcrl1 is a biomarker and an important target in B cell lymphoproliferative disorders[1][2][3]. FCRL1 Protein, Mouse (203a.a, HEK293, His) is the recombinant mouse-derived FCRL1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Fc receptor-like protein 1 (Fcrl1), a cell-surface membrane protein, belongs to FCRL family, and is preferentially expressed on B cells. Fcrl1, a BCR co-receptor, is an activating receptor which can enhance signaling through the B cell receptor. Fcrl1 promotes B cell proliferation and calcium mobilization[1]. Fcrl1 is a biomarker and an important therapeutic target in B cell lymphoproliferative disorders[2][3].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
A0A0R4J0W8/BAC30017.1 (A17-S219)
-
Molecular Construction
-
N-term
-
FCRL1 (A17-S219)
Accession # A0A0R4J0W8/BAC30017.1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FCRL1; Fc Receptor Homolog 1; Fc Receptor Like 1; FcR-Like Protein 1; FCRH1; HIFGP1; IRTA5; Immunoglobulin Superfamily Fc Receptor, Gp42; IFGP1; Fc Receptor-Like 1; CD307a; CD307a Antigen; Immune Receptor Translocation-Associated Protein 5; FcRH1; Fc Rece
-
AA Sequence
AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIPSELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLS
-
Predicted Molecular Mass
22.5 kDa
-
Molecular Weight
Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
