FCRL1 Protein, Mouse (203a.a, HEK293, His)

Fc receptor-like protein 1 (Fcrl1) is a cell-surface membrane protein that belongs to FCRL family. Fcrl1 is a BCR co-receptor and enhance signaling through the B cell receptor. Fcrl1 promotes B cell proliferation and calcium mobilization. Fcrl1 is a biomarker and an important target in B cell lymphoproliferative disorders^[1][2][3]. FCRL1 Protein, Mouse (203a.a, HEK293, His) is the recombinant mouse-derived FCRL1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FCRL1 Protein, Mouse (203a.a, HEK293, His) is 203 a.a., with molecular weight of ~40-54 kDa.

Fc receptor-like protein 1 (Fcrl1), a cell-surface membrane protein, belongs to FCRL family, and is preferentially expressed on B cells. Fcrl1, a BCR co-receptor, is an activating receptor which can enhance signaling through the B cell receptor. Fcrl1 promotes B cell proliferation and calcium mobilization^[1]. Fcrl1 is a biomarker and an important therapeutic target in B cell lymphoproliferative disorders^[2][3].

Mouse

HEK293

C-6*His

BAC30017.1 (A17-S219)

229499  [NCBI]

AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIPSELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLS

Approximately 40-54 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.