Copy Link Print Information

FGF-15 Protein, Mouse (His-SUMO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

FGF-15 Protein crucially suppresses bile acid biosynthesis by down-regulating CYP7A1 expression, contributing to intricate bile acid homeostasis control. Interacting with MALRD1 suggests potential involvement in molecular pathways beyond bile acid regulation. The molecular associations and regulatory functions underscore FGF-15's significance in maintaining physiological balance, particularly in bile acid metabolism. FGF-15 Protein, Mouse (His-SUMO) is the recombinant mouse-derived FGF-15 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-15 Protein, Mouse (His-SUMO)
  • FGF-15 Protein, Mouse (His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-15 Protein crucially suppresses bile acid biosynthesis by down-regulating CYP7A1 expression, contributing to intricate bile acid homeostasis control. Interacting with MALRD1 suggests potential involvement in molecular pathways beyond bile acid regulation. The molecular associations and regulatory functions underscore FGF-15's significance in maintaining physiological balance, particularly in bile acid metabolism. FGF-15 Protein, Mouse (His-SUMO) is the recombinant mouse-derived FGF-15 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

The FGF-15 Protein plays a crucial role in the suppression of bile acid biosynthesis by down-regulating CYP7A1 expression. Through its regulatory activity, FGF-15 contributes to the intricate control of bile acid homeostasis. Additionally, the protein interacts with MALRD1, suggesting potential involvement in molecular pathways and processes beyond bile acid regulation. The molecular associations and regulatory functions of FGF-15 highlight its significance in maintaining physiological balance, particularly in the context of bile acid metabolism.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession

    O35622 (R26-K218)

  • Gene ID
    14170  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • FGF-15 (R26-K218)
      Accession # O35622
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Fibroblast growth factor 15; FGF-15; Fgf15; FGF15_MOUSE; FGF19

  • AA Sequence

    RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK

  • Predicted Molecular Mass

    22.5 kDa

  • Molecular Weight

    Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • FGF-15 Protein, Mouse (His-SUMO) Product Image
    1/16
  • Experimental Validation Results for FGF-15 Protein, Mouse (His-SUMO)
  • FGF-15 Protein, Mouse (His-SUMO) Product Image