1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF family
  4. FGF
  5. FGF-2 Protein, Mouse (His)

FGF-2 Protein, Mouse (His)

Cat. No.: HY-P73052
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $115 In-stock
Estimated Time of Arrival: December 31
50 μg $325 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

FGF-2 Protein, Mouse (His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P15655 (A11-S154)

Gene ID

14173

Synonyms
Fibroblast growth factor 2; FGF-2; bFGF; HBGF-2; Fgf2
AA Sequence

ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Weight

Approximately 18.5 kDa

Purity

Greater than 95 % as determined by SDS-PAGE.

Biological Activity
Measured in a cell proliferation assay using Balb/c 3T3 mouse embryonic fibroblasts and the ED50 is typically 0.1-0.6 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-2 Protein, Mouse (His)
Cat. No.:
HY-P73052
Quantity:
MCE Japan Authorized Agent: