FGF-9 Protein, Human

FGF-9 Protein, Human is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells.

Fibroblast growth factor-9 (FGF-9) is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells. FGF-9, originally isolated from human glioma cells, has been found to be a potent mitogen and survival factor for numerous nerve cells, prostatic cells, and lung mesenchymal cells and is necessary for fetal testicular development^[1].

The ED₅₀ is <20 ng/mL as measured by 3T3 cells, corresponding to a specific activity of >5.0 × 10⁴ units/mg.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ this effect is 19.75 ng/mL, corresponding to a specific activity is 5.06×10⁴ U/mg.

Human

E. coli

Tag Free

P31371 (M1-S208)

2254  [NCBI]

Full Length

MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, pH 8.0.
4.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 8% trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Wing LY, et al. Expression and mitogenic effect of fibroblast growth factor-9 in human endometriotic implant is regulated by aberrant production of estrogen. J Clin Endocrinol Metab. 2003 Nov;88(11):5547-54.  [Content Brief]