FGF14 Protein, Canine

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free. The total length of FGF14 Protein, Canine is 189 a.a., with molecular weight of ~21 kDa.

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. As a member of the FGF homologous factor family, FGF14 is expressed in the developing and mature nervous system and maintains normal nervous system function by regulating the plasticity and excitability of neurons. Mutations in the FGF14 gene are responsible for the neurodegenerative spinocerebellar ataxia (SAC27), and FGF14 deficiency pimples on the maturation of cells in the hippocampal dentate gyrus, which may lead to schizophrenia. FGF14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling^[1][2][3].

Measured by its binding ability in a functional ELISA. When Recombinant Canine FGF14 is present at 2 μg/mL, can bind Recombinant Human FGFR4. The ED₅₀ for this effect is 299.1 ng/mL.

Canine

E. coli

Tag Free

XP_003363267 (K64-T252)

100050897  [NCBI]

KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT

Approximately 21 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.