FGF-14 Protein, Canine

Customer Review

Based on 1 Customer Validation

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.

Background

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. As a member of the FGF homologous factor family, FGF14 is expressed in the developing and mature nervous system and maintains normal nervous system function by regulating the plasticity and excitability of neurons. Mutations in the FGF14 gene are responsible for the neurodegenerative spinocerebellar ataxia (SAC27), and FGF14 deficiency pimples on the maturation of cells in the hippocampal dentate gyrus, which may lead to schizophrenia. FGF14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling[1][2][3].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Canine FGF14 is present at 2 μg/mL, can bind Recombinant Human FGFR4. The ED50 for this effect is 299.1 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Canine FGF14 is present at 2 μg/mL, can bind Recombinant Human FGFR4.The ED50 for this effect is 299.1 ng/mL.

Technical Parameters

  • Species Canine
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FGF-14 (K64-T252)
      Accession # XP_003363267.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FGF14; Nystagmus 4, Congenital Autosomal Dominant; Fibroblast Growth Factor 14; Fibroblast Growth Factor; FHF4; SCA27A; SCA27; SCA27B; Fibroblast Growth Factor Homologous Factor 4; NYS4; FGF-14; FGF; FHF-4

  • AA Sequence

    KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT

  • Predicted Molecular Mass

    21 kDa

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00