FGF-14 Protein, Canine
Based on 1 Customer Validation
Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.
- Species: Canine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.
Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. As a member of the FGF homologous factor family, FGF14 is expressed in the developing and mature nervous system and maintains normal nervous system function by regulating the plasticity and excitability of neurons. Mutations in the FGF14 gene are responsible for the neurodegenerative spinocerebellar ataxia (SAC27), and FGF14 deficiency pimples on the maturation of cells in the hippocampal dentate gyrus, which may lead to schizophrenia. FGF14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling[1][2][3].
Measured by its binding ability in a functional ELISA. When Recombinant Canine FGF14 is present at 2 μg/mL, can bind Recombinant Human FGFR4. The ED50 for this effect is 299.1 ng/mL.
Technical Parameters
-
Species Canine
-
Source E. coli
-
Tag Tag Free
-
Accession
XP_003363267.1 (K64-T252)
-
Gene ID100050897 [NCBI]
-
Molecular Construction
-
N-term
-
FGF-14 (K64-T252)
Accession # XP_003363267.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FGF14; Nystagmus 4, Congenital Autosomal Dominant; Fibroblast Growth Factor 14; Fibroblast Growth Factor; FHF4; SCA27A; SCA27; SCA27B; Fibroblast Growth Factor Homologous Factor 4; NYS4; FGF-14; FGF; FHF-4
-
AA Sequence
KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT
-
Predicted Molecular Mass
21 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
