1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. FGF Family Stem Cell CD Proteins Epithelial cell CD Proteins Receptor Tyrosine Kinases Cytokine Receptors Protein Tyrosine Kinases
  4. FGFR
  5. FGFR-3
  6. FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P76341
Handling Instructions Technical Support

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine and kidney. FGFR-3 regulates chondrocyte differentiation and proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 is a tumor marker. FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus-derived FGFR-3 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine and kidney. FGFR-3 regulates chondrocyte differentiation and proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 is a tumor marker. FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus-derived FGFR-3 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine and kidney. The FGFR-3 protein plays a role in bone growth by regulating ossification. FGFR-3 is an important regulator of intrachondral and membranous ossification and a negative regulator of long bone growth. FGFR-3 regulates chondrocyte differentiation and proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 is a tumor marker[1][2].

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

F7FZR9/XP_001101108.1 (E23-G375)

Gene ID
Molecular Construction
N-term
FGFR-3 (E23-G375)
Accession # F7FZR9/XP_001101108.1
hFc
C-term
Protein Length

Partial

Synonyms
Fibroblast growth factor receptor 3; FGFR-3; CD333; Mfr3; Sam3
AA Sequence

ESLGTEQRVVGRVAEVSGPEPSQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGAGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQLVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

Predicted Molecular Mass
65.1 kDa
Molecular Weight

Approximately 99.9 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P76341
Quantity:
MCE Japan Authorized Agent: