1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. FGF Family Stem Cell CD Proteins Epithelial cell CD Proteins Receptor Tyrosine Kinases Cytokine Receptors Protein Tyrosine Kinases
  4. FGFR
  5. FGFR-3
  6. FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

Cat. No.: HY-P76342
Handling Instructions Technical Support

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine and kidney. FGFR-3 regulates chondrocyte differentiation and proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 is a tumor marker. FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant cynomolgus-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine and kidney. FGFR-3 regulates chondrocyte differentiation and proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 is a tumor marker. FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant cynomolgus-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.

Background

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine and kidney. The FGFR-3 protein plays a role in bone growth by regulating ossification. FGFR-3 is an important regulator of intrachondral and membranous ossification and a negative regulator of long bone growth. FGFR-3 regulates chondrocyte differentiation and proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 is a tumor marker[1][2].

Biological Activity

1.This product does not contain protein kinase domain.
2.Measured by its ability to inhibit FGF-acidic dependent proliferation of Balb/c 3T3 mouse fibroblasts, the ED50 for this effect is typically 3.693 ng/mL, corresponding to a specific activity is 2.71×105 units/mg.

  • Measured by its ability to inhibit FGF-acidic dependent proliferation of Balb/c 3T3 mouse fibroblasts, the ED50 for this effect is typically 3.693 ng/mL, corresponding to a specific activity is 2.71×105 units/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

F7FZR9/XP_001101108.1 (E23-G375)

Gene ID
Molecular Construction
N-term
FGFR-3 (E23-G375)
Accession # F7FZR9/XP_001101108.1
His
C-term
Protein Length

Partial

Synonyms
Fibroblast growth factor receptor 3; FGFR-3; CD333; Mfr3; Sam3
AA Sequence

ESLGTEQRVVGRVAEVSGPEPSQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGAGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQLVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

분자량

Approximately 55-77 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P76342
수량:
MCE Japan Authorized Agent: