FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine and kidney. FGFR-3 regulates chondrocyte differentiation and proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 is a tumor marker. FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant cynomolgus-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine and kidney. The FGFR-3 protein plays a role in bone growth by regulating ossification. FGFR-3 is an important regulator of intrachondral and membranous ossification and a negative regulator of long bone growth. FGFR-3 regulates chondrocyte differentiation and proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 is a tumor marker^[1][2].

1.This product does not contain protein kinase domain.
2.Measured by its ability to inhibit FGF-acidic dependent proliferation of Balb/c 3T3 mouse fibroblasts, the ED₅₀ for this effect is typically 3.693 ng/mL, corresponding to a specific activity is 2.71×10⁵ units/mg.

• 
  Measured by its ability to inhibit FGF-acidic dependent proliferation of Balb/c 3T3 mouse fibroblasts, the ED₅₀ for this effect is typically 3.693 ng/mL, corresponding to a specific activity is 2.71×10⁵ units/mg.

Rhesus Macaque

HEK293

C-6*His

F7FZR9/XP_001101108.1 (E23-G375)

712829  [NCBI]

Partial

ESLGTEQRVVGRVAEVSGPEPSQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGAGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQLVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

Approximately 55-77 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.