FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

For research use only. We do not sell to patients.

* Please select Quantity before adding items.

FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) Featured Recommendations:

Species	Rhesus Macaque
Source	HEK293
Tag	C-6*His
Accession	F7FZR9/XP_005554344.1 (E23-G375)
Gene ID	712829 [NCBI]
Molecular Construction	N-term FGFR-3 (E23-G375) Accession # F7FZR9/XP_005554344.1 His C-term
Synonyms	Fibroblast growth factor receptor 3; FGFR-3; CD333; Mfr3; Sam3
AA Sequence	ESLGTEQRVVGRVAEVSGPEPSQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGAGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQLVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
Molecular Weight	Approximately 55-77 kDa due to the glycosylation.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Documentation	Data Sheet (237 KB) Handling Instructions (2659 KB)

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.