1. Recombinant Proteins
  2. Others
  3. FGG/Fibrinogen gamma chain Protein, Mouse (P.pastoris)

FGG/Fibrinogen gamma chain Protein, Mouse (P.pastoris)

Cat. No.: HY-P702579
Handling Instructions Technical Support

FGG (fibrinogen gamma chain) proteins cooperate with FGA and FGB to form an insoluble fibrin matrix that is critical for hemostasis and wound repair. Although FGG is not required for thrombosis, it stabilizes lesions and guides cell migration during epithelialization. FGG/Fibrinogen gamma chain Protein, Mouse (P.pastoris, Tag Free) is the recombinant mouse-derived FGG/Fibrinogen gamma chain, expressed by P. pastoris, with tag-free. The total length of FGG/Fibrinogen gamma chain Protein, Mouse (P.pastoris, Tag Free) is 269 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FGG (fibrinogen gamma chain) proteins cooperate with FGA and FGB to form an insoluble fibrin matrix that is critical for hemostasis and wound repair. Although FGG is not required for thrombosis, it stabilizes lesions and guides cell migration during epithelialization. FGG/Fibrinogen gamma chain Protein, Mouse (P.pastoris, Tag Free) is the recombinant mouse-derived FGG/Fibrinogen gamma chain, expressed by P. pastoris, with tag-free. The total length of FGG/Fibrinogen gamma chain Protein, Mouse (P.pastoris, Tag Free) is 269 a.a..

Background

The FGG (Fibrinogen gamma chain) protein collaborates with fibrinogen alpha (FGA) and fibrinogen beta (FGB) to polymerize and form an insoluble fibrin matrix, a crucial element in hemostasis and blood clot formation. Additionally, FGG functions in the early stages of wound repair by stabilizing lesions and guiding cell migration during re-epithelialization. Despite initial beliefs suggesting its essential role in platelet aggregation, subsequent in vivo studies revealed that FGG is not absolutely required for thrombus formation. FGG also plays a role in enhancing the expression of SELP in activated platelets through an ITGB3-dependent pathway. Moreover, maternal fibrinogen is vital for successful pregnancy, and fibrin deposition is associated with infection, providing protection against IFNG-mediated hemorrhage. FGG may further contribute to the immune response through both innate and T-cell mediated pathways. Structurally, FGG forms a heterohexamer through disulfide linkage, consisting of two sets of three non-identical chains (alpha, beta, and gamma), arranged in a head-to-head conformation with the N-termini in a small central domain.

Species

Mouse

Source

P. pastoris

Tag

Tag Free

Accession

Q8VCM7 (V168-V436)

Gene ID

99571

Protein Length

Partial

Synonyms
Fibrinogen gamma chain; FGG; PRO2061
AA Sequence

VQIHDTTGKDCQEIANKGAKESGLYFIRPLKAKQQFLVYCEIDGSGNGWTVLQKRIDGSLDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWNGRTSTADYAMFRVGPESDKYRLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYHQGGTYSKSSTTNGFDDGIIWATWKSRWYSMKETTMKIIPFNRLSIGEGQQHHMGGSKQAGDV

Predicted Molecular Mass
30.5 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

FGG/Fibrinogen gamma chain Protein, Mouse (P.pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGG/Fibrinogen gamma chain Protein, Mouse (P.pastoris)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGG/Fibrinogen gamma chain Protein, Mouse (P.pastoris)
Cat. No.:
HY-P702579
Quantity:
MCE Japan Authorized Agent: