Copy Link Print Information

FimH Protein, E.coli (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

FimH Protein, pivotal in regulating length, mediates adhesion for type 1 fimbriae without being essential for fimbriae production. Positioned laterally in the fimbriae structure, FimH primarily binds to D-mannose. FimH integration into fimbriae involves collaborative action with FimF and FimG, emphasizing the coordinated molecular interplay essential for type 1 fimbriae assembly and function. FimH Protein, E.coli (P.pastoris, His) is the recombinant Virus-derived FimH protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • FimH Protein, E.coli (P.pastoris, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FimH Protein, pivotal in regulating length, mediates adhesion for type 1 fimbriae without being essential for fimbriae production. Positioned laterally in the fimbriae structure, FimH primarily binds to D-mannose. FimH integration into fimbriae involves collaborative action with FimF and FimG, emphasizing the coordinated molecular interplay essential for type 1 fimbriae assembly and function. FimH Protein, E.coli (P.pastoris, His) is the recombinant Virus-derived FimH protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

FimH protein plays a pivotal role in the intricate regulation of length and serves as a mediator for the adhesion process associated with type 1 fimbriae, albeit not indispensable for fimbriae production. This adhesin assumes a lateral position at intervals within the type 1 fimbriae structure and is primarily responsible for binding to D-mannose. The integration of FimH into the fimbriae structure necessitates the collaborative action of FimF and FimG, emphasizing the coordinated molecular interplay required for the assembly and functional manifestation of type 1 fimbriae.

Technical Parameters

  • Species Virus
  • Source P. pastoris
  • Tag N-6*His
  • Accession

    P08191 (F22-Q300)

  • Gene ID
    948847  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • FimH (F22-Q300)
      Accession # P08191
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Type 1 fimbrin D-mannose specific adhesin; Protein FimH; fimH; b4320; JW4283

  • AA Sequence

    FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ

  • Predicted Molecular Mass

    31.1 kDa

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FimH Protein, E.coli (P.pastoris, His) Product Image
    1/16
  • FimH Protein, E.coli (P.pastoris, His) Product Image