1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins CD Antigens Receptor Proteins Fluorescent-labeled Recombinant Proteins
  3. TNF Superfamily B Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily BCMA/CD269
  5. B Cell Maturation Antigen (BCMA)
  6. FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His)

FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His)

Cat. No.: HY-P701296
Handling Instructions Technical Support

BCMA/TNFRSF17 Protein, a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, crucially promotes B-cell survival and regulates humoral immunity. Activating NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in immune response signaling pathways. It associates with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, indicating involvement in various cellular processes mediated by these adaptor proteins. FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His) is the recombinant human-derived FITC-labeled BCMA/TNFRSF17 protein, expressed by HEK293 , with His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BCMA/TNFRSF17 Protein, a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, crucially promotes B-cell survival and regulates humoral immunity. Activating NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in immune response signaling pathways. It associates with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, indicating involvement in various cellular processes mediated by these adaptor proteins. FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His) is the recombinant human-derived FITC-labeled BCMA/TNFRSF17 protein, expressed by HEK293 , with His labeled tag.

Background

The BCMA/TNFRSF17 protein serves as a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, exerting essential functions in promoting B-cell survival and contributing to the regulation of humoral immunity. Through its activation of NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in signaling pathways associated with immune responses. Additionally, it forms associations with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, suggesting its involvement in various cellular processes mediated by these adaptor proteins.

Species

Human

Source

HEK293

Tag

His

Accession

Q02223 (M1-A54)

Gene ID

608

Protein Length

Extracellular Domain

Synonyms
TNFRSF17; CD269; BCM; BCMA
AA Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Predicted Molecular Mass
7.8 kDa
Molecular Weight

Approximately 10 kDa & 14-17 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His)
Cat. No.:
HY-P701296
Quantity:
MCE Japan Authorized Agent: