FITC-Labeled CD99 Protein, Human (HEK293, Fc)

The CD99 protein is involved in the important T cell adhesion process and helps red blood cells spontaneously form rosettes. It also contributes to the later stages of leukocyte extravasation, helping leukocytes to overcome the endothelial basement membrane during the immune response. FITC-Labeled CD99 Protein, Human (HEK293, Fc) is the recombinant human-derived FITC-Labeled CD99 protein, expressed by HEK293 , with Fc labeled tag.

CD99 protein participates in crucial T-cell adhesion processes, contributing to spontaneous rosette formation with erythrocytes. Additionally, it plays a vital role in the late stages of leukocyte extravasation, aiding leukocytes in overcoming the endothelial basement membrane during immune responses. Remarkably, its function is independent of PECAM1, although it acts at the same site. The involvement of CD99 in T-cell adhesion processes underscores its significance in mediating cellular interactions essential for immune function.

Human

HEK293

Fc

P14209-1 (D23-D122)

4267

Extracellular Domain

DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD

Approximately 45-55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.