FITC-Labeled Delta-like protein 3/DLL3 Protein, Human (HEK293, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. FITC-Labeled Delta-like protein 3/DLL3 Protein, Human (HEK293, His) is the recombinant human-derived FITC-Labeled Delta-like protein 3/DLL3 protein, expressed by HEK293 , with His labeled tag.

Delta-like protein 3/DLL3 emerges as a key regulator in the intricate landscape of neurogenesis and cellular differentiation. Acting as an inhibitor of primary neurogenesis, DLL3 is believed to play a crucial role in steering neurons along specific differentiation pathways. Its involvement extends beyond neurogenesis, contributing to the formation of somite boundaries during the segmentation of the paraxial mesoderm. Notably, DLL3 exhibits the capability to bind and activate Notch-1 or other Notch receptors, underscoring its significance in orchestrating cellular processes that govern developmental pathways and cellular fate determination.

Measured by its binding ability in a functional ELISA.Immobilized Anti-DLL3 Antibody (specific Binding DSL of DLL3), Human IgG1 at 2 μg/mL (100 μL/well) can bind FITC-Labeled Human DLL3, His Tag with the EC₅₀ of 0.22 μg/mL.

Human

HEK293

C-His

Q9NYJ7-1 (A27-L492)

10683

Extracellular Domain

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Approximately 50-55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS,0.2 M Arginine, pH7.4 with 10% trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.