FITC-Labeled EpCAM/TROP1 Protein, Human (HEK293, Fc)

The EpCAM/TROP1 protein serves as an important homogeneous interacting molecule that promotes direct contact between intestinal epithelial cells (IEC) and intraepithelial lymphocytes (IEL) in the mucosal epithelium. This feature helps establish an immune barrier against mucosal infections. FITC-Labeled EpCAM/TROP1 Protein, Human (HEK293, Fc) is the recombinant human-derived FITC-Labeled EpCAM/TROP1 protein, expressed by HEK293 , with Fc labeled tag.

The EpCAM/TROP1 Protein emerges as a pivotal entity, potentially functioning as a physical homophilic interaction molecule that fosters direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium, thereby contributing to the establishment of an immunological barrier as the primary defense against mucosal infections. Beyond its role in mucosal immunity, this protein plays a significant part in the proliferation and differentiation of embryonic stem cells. It further exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricate molecular interactions involved, providing insights into the diverse functions of this protein in cellular physiology.

Human

HEK293

Fc

AAH14785.1 (Q24-K265)

4072

Partial

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Approximately 60-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.