FLT3LG Protein, Human

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. FLT3LG Protein, Human is the recombinant human-derived FLT3LG protein, expressed by E. coli , with tag free.

FLT3LG protein serves as a potent stimulator of early hematopoietic cell proliferation through the activation of FLT3, demonstrating synergistic effects when combined with various colony-stimulating factors and interleukins. This homodimeric protein, particularly in isoform 2, plays a crucial role in promoting the expansion and differentiation of hematopoietic progenitor cells. Its ability to activate FLT3 and collaborate with other signaling molecules underscores its significance in regulating hematopoiesis and maintaining the balance of the hematopoietic system.

1.Immobilized Human FLT3LG, No Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Human FLT3, hFc Tag with the EC₅₀ of 20-100 ng/mL determined by ELISA.
2.The ED₅₀ was determined by the dose-dependent stimulation of the proliferation of human AML5 cells is < 2.0 ng/mL.
3. Immobilized Human FLT3LG, No Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Human FLT3, hFc Tag with the EC₅₀ of 30.8 ng/mL determined by ELISA.

• 
  The ED₅₀ is 1.0 ng/mL, as determined by stimulation of the proliferation of human AML5 cells.

Human

E. coli

Tag Free

P49771-1 (T27-A181)

2323

Extracellular Domain

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

< 1 EU/μg of protein by gel clotting method

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/wm164-cell.html  [Content Brief]